Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MQGRRELGGEPLSDLQEEAASASLRVAPERLSDDSLEWRRTCPDLLLSDGKASISMPREGGSTCTARCPD      1 - 70
PGEHSSTWGEFEGFRESSAKSGQFSQSLELLEGPTEPQPPRTTSAPKECSSHQPCQGGPWVTGTSAVPPS     71 - 140
EPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKLWRALQSIHTTSTSQ    141 - 210
RLWSESRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSK    211 - 280
QGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKLKLTLFNSDVC                             281 - 325
//

Text Mined References (7)

PMID Year Title
16112646 2005 Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.