Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
R01 Count 2
Funding $237,606.47
PubMed Score 9.43
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSTAPSLSALRSSKHSGGGGGGGGGGGADPAWTSALSGNSSGPGPGSSPAGSTKPFVHAVPPSDPLRQAN      1 - 70
RLPIKVLKMLTARTGHILHPEYLQPLPSTPVSPIELDAKKSPLALLAQTCSQIGKPDPSPSSKLSSVASN     71 - 140
GGGAGGAGGGAAGDKDTKSGPLKLSDIGVEDKSSFKPYSKPGSDKKEPGGGGGGGGGGGGGGGGVSSEKS    141 - 210
GFRVPSATCQPFTPRTGSPSSSASACSPGGMLSSAGGAPEGKDDKKDTDVGGGGKGTGGASAEGGPTGLA    211 - 280
HGRISCGGGINVDVNQHPDGGPGGKALGSDCGGSSGSSSGSGPSAPTSSSVLGSGLVAPVSPYKPGQTVF    281 - 350
PLPPAGMTYPGSLAGAYAGYPPQFLPHGVALDPTKPGSLVGAQLAAAAAGSLGCSKPAGSSPLAGASPPS    351 - 420
VMTASLCRDPYCLSYHCASHLAGAAAASASCAHDPAAAAAALKSGYPLVYPTHPLHGVHSSLTAAAAAGA    421 - 490
TPPSLAGHPLYPYGFMLPNDPLPHICNWVSANGPCDKRFATSEELLSHLRTHTAFPGTDKLLSGYPSSSS    491 - 560
LASAAAAAMACHMHIPTSGAPGSPGTLALRSPHHALGLSSRYHPYSKSPLPTPGAPVPVPAATGPYYSPY    561 - 630
ALYGQRLTTASALGYQ                                                          631 - 646
//

Text Mined References (9)

PMID Year Title
20735826 2010 Nolz1 promotes striatal neurogenesis through the regulation of retinoic acid signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19014486 2008 Nlz1/Znf703 acts as a repressor of transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983057 2004 Identification of a developmentally regulated striatum-enriched zinc-finger gene, Nolz-1, in the mammalian brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.