Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.43
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.16547177820293E-5
ovarian cancer 8492 1.18560569004361E-4
tuberculosis and treatment for 6 months 686 1.46474152383689E-4
pituitary cancer 1972 1.96053238061924E-4
Breast cancer 3099 7.877721782513E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0012877574513481
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00312474576444601
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00478707507077636
non primary Sjogren syndrome sicca 840 0.0131685731252263
primary pancreatic ductal adenocarcinoma 1271 0.0152840156380114
pancreatic cancer 2300 0.016240628485519
adrenocortical carcinoma 1427 0.0280625768292251
group 4 medulloblastoma 1875 0.0309652636163422
Hydrolethalus syndrome 128 0.0362624571621455
Disease Target Count Z-score Confidence
Coloboma 52 3.175 1.6

Expression

Synonym

Accession Q96F45 Q8NAC5 Q96E25 Q96IJ0
Symbols Nlz2
NOLZ1
NOLZ-1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

AA Sequence

MSTAPSLSALRSSKHSGGGGGGGGGGGADPAWTSALSGNSSGPGPGSSPAGSTKPFVHAVPPSDPLRQAN      1 - 70
RLPIKVLKMLTARTGHILHPEYLQPLPSTPVSPIELDAKKSPLALLAQTCSQIGKPDPSPSSKLSSVASN     71 - 140
GGGAGGAGGGAAGDKDTKSGPLKLSDIGVEDKSSFKPYSKPGSDKKEPGGGGGGGGGGGGGGGGVSSEKS    141 - 210
GFRVPSATCQPFTPRTGSPSSSASACSPGGMLSSAGGAPEGKDDKKDTDVGGGGKGTGGASAEGGPTGLA    211 - 280
HGRISCGGGINVDVNQHPDGGPGGKALGSDCGGSSGSSSGSGPSAPTSSSVLGSGLVAPVSPYKPGQTVF    281 - 350
PLPPAGMTYPGSLAGAYAGYPPQFLPHGVALDPTKPGSLVGAQLAAAAAGSLGCSKPAGSSPLAGASPPS    351 - 420
VMTASLCRDPYCLSYHCASHLAGAAAASASCAHDPAAAAAALKSGYPLVYPTHPLHGVHSSLTAAAAAGA    421 - 490
TPPSLAGHPLYPYGFMLPNDPLPHICNWVSANGPCDKRFATSEELLSHLRTHTAFPGTDKLLSGYPSSSS    491 - 560
LASAAAAAMACHMHIPTSGAPGSPGTLALRSPHHALGLSSRYHPYSKSPLPTPGAPVPVPAATGPYYSPY    561 - 630
ALYGQRLTTASALGYQ                                                          631 - 646
//

Text Mined References (9)

PMID Year Title
20735826 2010 Nolz1 promotes striatal neurogenesis through the regulation of retinoic acid signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19014486 2008 Nlz1/Znf703 acts as a repressor of transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983057 2004 Identification of a developmentally regulated striatum-enriched zinc-finger gene, Nolz-1, in the mammalian brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.