Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.424 1.7e-04
adult high grade glioma -1.300 8.7e-05
astrocytic glioma -1.100 3.9e-03
atypical teratoid / rhabdoid tumor -1.800 1.9e-06
Breast cancer 1.100 1.9e-06
ductal carcinoma in situ 1.300 4.0e-03
ependymoma -1.800 4.7e-02
glioblastoma -1.600 1.7e-04
invasive ductal carcinoma 2.000 1.0e-04
lung adenocarcinoma 1.100 2.3e-05
lung cancer 3.500 1.6e-05
lung carcinoma 1.800 1.1e-44
medulloblastoma, large-cell -1.400 3.4e-04
non-small cell lung cancer 1.030 1.0e-09
osteosarcoma -1.434 2.2e-03
subependymal giant cell astrocytoma -1.920 3.8e-02

AA Sequence

MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALFSGLSGSLPTS      1 - 70
SFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGGHRGGSLLQHVGGDHRGHSEE     71 - 140
GGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQHKLGIAVCIGMASTFAYANSTLREQVSLKE    141 - 210
KRSVLVILWILAFLAGNTLYVLYTFSSQQLYNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCL    211 - 280
IVALPKIILAVKSKGKFYLVIEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICG    281 - 350
RVGGVRKALKLLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL    351 - 420
CRSVAVDTLRCWKDGATSAHFQVY                                                  421 - 444
//

Text Mined References (7)

PMID Year Title