Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.100 0.004
ependymoma -1.800 0.047
osteosarcoma -1.490 0.005
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.400 0.000
adrenocortical carcinoma 1.424 0.000
non-small cell lung cancer 1.030 0.000
lung cancer 4.100 0.000
pediatric high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.920 0.038
lung adenocarcinoma 1.100 0.000
Breast cancer 1.800 0.000
lung carcinoma 1.800 0.000
ductal carcinoma in situ 1.300 0.004
invasive ductal carcinoma 2.000 0.000

AA Sequence

MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALFSGLSGSLPTS      1 - 70
SFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGGHRGGSLLQHVGGDHRGHSEE     71 - 140
GGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQHKLGIAVCIGMASTFAYANSTLREQVSLKE    141 - 210
KRSVLVILWILAFLAGNTLYVLYTFSSQQLYNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCL    211 - 280
IVALPKIILAVKSKGKFYLVIEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICG    281 - 350
RVGGVRKALKLLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL    351 - 420
CRSVAVDTLRCWKDGATSAHFQVY                                                  421 - 444
//

Text Mined References (7)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22005931 2012 Genome-wide association analysis of age-at-onset in Alzheimer's disease.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.