Property Summary

NCBI Gene PubMed Count 6
PubMed Score 26.63
PubTator Score 13.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.849 0.000
group 3 medulloblastoma 1.300 0.004
astrocytoma 1.300 0.007
acute quadriplegic myopathy 1.232 0.000
subependymal giant cell astrocytoma 1.529 0.022
ovarian cancer 1.700 0.000
dermatomyositis 1.200 0.004

Gene RIF (3)

PMID Text
25359680 Data suggest a novel role and a possible link for HSPBAP1 in promoting prostate cancer cell survival in androgen-deficient conditions by maintaining a basal level of androgen receptor-mediated transcription.
17568411 HSPBAP1 is found extensively in the anterior temporal neocortex of patients with intractable epilepsy.
11978969 Molecular cloning and characterization of a novel human gene (HSPBAP1) from human fetal brain

AA Sequence

MAAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGK      1 - 70
QIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKT     71 - 140
DLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIP    141 - 210
YEESSVFSKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHL    211 - 280
ARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTD    281 - 350
GEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDK    351 - 420
DGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQLLIQGRSL      421 - 488
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25359680 2015 Androgen receptor-interacting protein HSPBAP1 facilitates growth of prostate cancer cells in androgen-deficient conditions.
17568411 2007 HSPBAP1 is found extensively in the anterior temporal neocortex of patients with intractable epilepsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939738 2003 Disruption of a novel gene, DIRC3, and expression of DIRC3-HSPBAP1 fusion transcripts in a case of familial renal cell cancer and t(2;3)(q35;q21).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11978969 2001 Molecular cloning and characterization of a novel human gene (HSPBAP1) from human fetal brain.
10751411 2000 Identification and characterization of a novel protein from Sertoli cells, PASS1, that associates with mammalian small stress protein hsp27.