Property Summary

NCBI Gene PubMed Count 172
Grant Count 97
R01 Count 33
Funding $16,772,051.04
PubMed Score 272.98
PubTator Score 243.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.000 0.018
ependymoma -1.800 0.020
oligodendroglioma -1.900 0.016
group 4 medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.600 0.023
intraductal papillary-mucinous neoplasm ... -1.700 0.000
adult high grade glioma -1.100 0.001

Synonym

Accession Q96EV8 A8K3V3 Q5THY3 Q5THY4 Q96NV2 Q9H0U2 Q9H3J5
Symbols SDY
DBND
HPS7
My031
BLOC1S8

Gene

Gene RIF (191)

PMID Text
26285059 Authors report the examination of DNA methylation status of DTNBP1 promoter region, one of the most credible candidate genes affected in SCZ.
26171858 dysbindin-1A protein levels are highly regulated in the nucleus and that dysbindin-1A regulates transcription factor NF-kappa B activity to promote the expression of MMP-9 and TNF-alpha
25704251 Study demonstrated that dysbindin-1B, rather than dysbindin-1A and dysbindin-1C, has the ability to aggregate
25697573 DTNBP1 is likely to play a role in development of auditory related, visual and olfactory hallucinations
25635053 DISC1 forms a complex with dysbindin and increases its stability in association with a reduction in ubiquitylation.
25530342 Findings add further evidence suggesting an association between dysbindin gene variability and cognitive abnormalities in schizophrenia.
25303981 rs3213207 polymorphism may contribute to methamphetamine-induced panic disorder
25298178 The present findings intransgenic mice expressing human DTNBP1 support the role of dysbindin-1 in psychiatric disorders.
25196196 dysbindin-1 formed a protein complex with HDAC3 in human neuroblastoma cells
25042954 In homozygotes and heterozygotes of risk allele (CC) of DTNBP1, there was a trend to volumetric reductions in brain regions, regardless of schizophrenia diagnosis.
More...

AA Sequence

MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA      1 - 70
SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG     71 - 140
QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY    141 - 210
LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE    211 - 280
ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD    281 - 350
S//

Text Mined References (179)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26285059 2015 Antipsychotic drugs attenuate aberrant DNA methylation of DTNBP1 (dysbindin) promoter in saliva and post-mortem brain of patients with schizophrenia and Psychotic bipolar disorder.
26171858 2015 The Schizophrenia-Related Protein Dysbindin-1A Is Degraded and Facilitates NF-Kappa B Activity in the Nucleus.
25704251 2015 Propagation of dysbindin-1B aggregates: exosome-mediated transmission of neurotoxic deposits.
25697573 2015 Dysbindin (DTNBP1) variants are associated with hallucinations in schizophrenia.
25635053 2015 Disrupted-in-schizophrenia 1 (DISC1) regulates dysbindin function by enhancing its stability.
25530342 2015 Dysbindin gene variability is associated with cognitive abnormalities in first-episode non-affective psychosis.
25416956 2014 A proteome-scale map of the human interactome network.
25303981 Genetic polymorphism in DTNBP1 gene is associated with methamphetamine-induced panic disorder.
25298178 2014 Behavioral characterization of mice overexpressing human dysbindin-1.
More...