Property Summary

NCBI Gene PubMed Count 48
Grant Count 6
Funding $306,237.51
PubMed Score 52.39
PubTator Score 24.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (19)

PMID Text
26789245 crystal structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation
26578682 This study describes a novel posttranslational regulation of the HOIP-containing linear-ubiquitin-chain assembly complex (LUBAC)-mediated linear ubiquitination that is critical for specifically directing TLR4-mediated NF-kappaB activation.
26231797 These findings collectively indicated an oncogene role of RNF31 in PCa progression which can be regulated by miR-503, suggesting that RNF31 could serve as a potential prognostic biomarker and therapeutic target for PCa.
26148235 RNF31 decreased p53 stability. RNF31 depletion caused cell cycle arrest and cisplatin-induced apoptosis in a p53-dependent manner. RNF31 associated with the p53/MDM2 complex, facilitating p53 polyubiquitination and degradation by stabilizing MDM2.
26038114 we identified BCL10 as a bona fide target of BCR-induced linear ubiquitylation and demonstrated an important role of the linear ubiquitin ligase HOIP in BCR-induced phosphorylation
26008899 human HOIP is essential for the assembly and function of LUBAC, which includes HOIL-1, and for various processes governing inflammation and immunity in both hematopoietic and nonhematopoietic cells
24726327 HOIP binding to OTULIN is required for the recruitment of OTULIN to the TNF receptor complex.
24726323 Phosphorylation of OTULIN prevents HOIP binding, whereas unphosphorylated OTULIN is part of the endogenous LUBAC complex.
24491438 Two rare germline polymorphisms affecting the LUBAC subunit RNF31 were identified and enriched among patients with activated B cell-like subtype of diffuse large B-cell lymphoma.
24441041 RNF31, via stabilizing ESR1 levels, controls the transcription of estrogen-dependent genes linked to breast cancer cell proliferation.
More...

AA Sequence

MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLN      1 - 70
TLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEE     71 - 140
PDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVP    141 - 210
GSTPGPCFLCGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQ    211 - 280
STSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLA    281 - 350
RGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF    351 - 420
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQ    421 - 490
LVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLD    491 - 560
RHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPE    561 - 630
PTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA    631 - 700
VCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLR    701 - 770
ESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS    771 - 840
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNK    841 - 910
CPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNG    911 - 980
LRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQ    981 - 1050
ARLLQKLTEEVPLGQSIPRRRK                                                   1051 - 1072
//

Text Mined References (53)

PMID Year Title
27559085 2016 Biallelic hypomorphic mutations in a linear deubiquitinase define otulipenia, an early-onset autoinflammatory disease.
27523608 2016 The Deubiquitinase OTULIN Is an Essential Negative Regulator of Inflammation and Autoimmunity.
26997266 2016 CYLD Limits Lys63- and Met1-Linked Ubiquitin at Receptor Complexes to Regulate Innate Immune Signaling.
26789245 2016 Structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation.
26578682 2015 Posttranslational Modification of HOIP Blocks Toll-Like Receptor 4-Mediated Linear-Ubiquitin-Chain Formation.
26231797 2015 miR-503 suppresses tumor cell proliferation and metastasis by directly targeting RNF31 in prostate cancer.
26148235 2016 RING finger protein 31 promotes p53 degradation in breast cancer cells.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
26008899 2015 Human HOIP and LUBAC deficiency underlies autoinflammation, immunodeficiency, amylopectinosis, and lymphangiectasia.
25416956 2014 A proteome-scale map of the human interactome network.
More...