Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 0.022
osteosarcoma -1.754 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.003
medulloblastoma, large-cell -1.800 0.000
tuberculosis 1.300 0.000
adult high grade glioma -1.400 0.002
group 4 medulloblastoma -1.100 0.010
ovarian cancer 1.300 0.000

Synonym

Accession Q96EN9 E9PAS0 Q8NAX4 Q9NWI0
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19770013 A human protein of unknown function FLJ20850 interacted specifically with deletion mutant hepatitis B core proteins.

AA Sequence

MITETAAEPTVPAVPAAEEATEARGREEPAWPWKDAPIRTLVQRIHQLQAERAQGFRRLEEWLAPVQGLR      1 - 70
AWGRGLRVPTCRRGHRQYLRSGPDYDFARYRSTVHGVTQAFAAASREVLAVEAELGGPRRQPLLAGHVRS     71 - 140
LQELEQTRLGTVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE             141 - 201
//

Text Mined References (10)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19770013 2009 A novel human protein is able to interact with hepatitis B virus core deletion mutant but not with the wild-type protein.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.