Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-03
astrocytic glioma -1.100 2.2e-02
atypical teratoid / rhabdoid tumor -1.300 1.0e-05
glioblastoma -1.300 3.0e-03
group 4 medulloblastoma -1.100 1.0e-02
medulloblastoma, large-cell -1.800 2.8e-06
osteosarcoma -1.633 2.6e-08
ovarian cancer 1.300 1.1e-05
tuberculosis 1.100 1.7e-07

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MITETAAEPTVPAVPAAEEATEARGREEPAWPWKDAPIRTLVQRIHQLQAERAQGFRRLEEWLAPVQGLR      1 - 70
AWGRGLRVPTCRRGHRQYLRSGPDYDFARYRSTVHGVTQAFAAASREVLAVEAELGGPRRQPLLAGHVRS     71 - 140
LQELEQTRLGTVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE             141 - 201
//

Text Mined References (11)

PMID Year Title