Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.41
PubTator Score 3.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 7.59075022010804E-18
osteosarcoma 7933 7.11198645475979E-8
tuberculosis and treatment for 6 months 686 1.88533919153938E-6
malignant mesothelioma 3163 2.11167215121726E-6
ovarian cancer 8492 2.1472544752858E-5
psoriasis 6685 1.327379570382E-4
group 3 medulloblastoma 2254 4.77776450984486E-4
medulloblastoma, large-cell 6234 5.74499410022796E-4
lung cancer 4473 9.98533977835554E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0275883521044133
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0288592549286079

Expression

  Differential Expression (11)

Synonym

Accession Q96EC8 B4E1U7 G5E997 Q5JP08
Symbols FinGER6

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

AA Sequence

MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVG      1 - 70
KKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKL     71 - 140
LGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPN    141 - 210
RRALAVYPVFLFYFVISWMILTFTPQ                                                211 - 236
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...