Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.73
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.200 7.6e-18
group 3 medulloblastoma 1.200 4.8e-04
intraductal papillary-mucinous adenoma (... 1.200 2.8e-02
intraductal papillary-mucinous carcinoma... 1.100 1.4e-02
lung cancer -1.500 1.0e-03
malignant mesothelioma 1.200 2.1e-06
medulloblastoma, large-cell -1.200 5.7e-04
osteosarcoma 1.388 2.5e-05
ovarian cancer -1.400 1.1e-06
psoriasis 1.300 1.3e-04
tuberculosis -1.100 3.6e-07

Gene RIF (2)

AA Sequence

MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVG      1 - 70
KKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKL     71 - 140
LGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPN    141 - 210
RRALAVYPVFLFYFVISWMILTFTPQ                                                211 - 236
//

Text Mined References (17)

PMID Year Title