Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.10
PubTator Score 12.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 63 1 0.0 0.0
Disease Target Count P-value
ependymoma 4679 4.5e-02
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 5.264 2.6
Disease Target Count Z-score Confidence
Hodgkin's lymphoma, nodular sclerosis 22 3.56 1.8

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV      1 - 70
ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME     71 - 140
EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL                      141 - 192
//

Text Mined References (13)

PMID Year Title