Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.22
PubTator Score 5.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 2.000 0.000
nasopharyngeal carcinoma 1.300 0.000
ovarian cancer 1.800 0.001

Synonym

Accession Q96E29 B3KMG6 G3V130 Q9Y301
Symbols CGI-12
MTERFD1

Gene

PDB

3M66  

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20577816 MTERFD1 and MTERFD3 have a role in impairing the completion of mitochondrial DNA replication

AA Sequence

MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKTYRTSSLWNSS      1 - 70
QSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLP     71 - 140
PASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLT    141 - 210
KNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLV    211 - 280
VRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVK    281 - 350
FPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL       351 - 417
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20577816 2011 Overexpression of MTERFD1 or MTERFD3 impairs the completion of mitochondrial DNA replication.
20430012 2010 Structure of mitochondrial transcription termination factor 3 reveals a novel nucleic acid-binding domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17662942 2007 MTERF3 is a negative regulator of mammalian mtDNA transcription.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
More...