Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.47629741691693E-6
posterior fossa group B ependymoma 1530 4.32365266317314E-6
cystic fibrosis 1670 9.45062028682787E-5
Disease Target Count Z-score Confidence
Follicular adenoma 8 3.666 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.100 0.000
posterior fossa group B ependymoma 1.100 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q96E16 B2R4S6 D3DSY4
Symbols C8orf40

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

AA Sequence

MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTEETLSEPNFYD      1 - 70
TISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE                                      71 - 107
//

Text Mined References (7)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.