| Tbio | CAP-Gly domain-containing linker protein 3 |
Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics. May modulate the cellular compartmentalization of AKT kinase family and promote its cell membrane localization, thereby playing a role in glucose transport in adipocytes.
This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
Comments
Property Summary
| NCBI Gene PubMed Count | 12 |
| Grant Count | 6 |
| R01 Count | 5 |
| Funding | $371,639.4 |
| PubMed Score | 11.19 |
| PubTator Score | 8.93 |
| Disease | log2 FC | p |
|---|---|---|
| psoriasis | -1.400 | 0.000 |
| glioblastoma | -1.500 | 0.000 |
| posterior fossa group B ependymoma | -1.900 | 0.000 |
| atypical teratoid/rhabdoid tumor | -1.500 | 0.000 |
| medulloblastoma, large-cell | -2.400 | 0.000 |
| colon cancer | -1.100 | 0.004 |
| adult high grade glioma | -1.600 | 0.000 |
| group 3 medulloblastoma | -1.800 | 0.000 |
| lung carcinoma | 1.400 | 0.000 |
| Pick disease | -1.400 | 0.000 |
| ovarian cancer | -1.600 | 0.000 |
| PMID | Text |
|---|---|
| 26017671 | CLIPR-59 interacts with Spy1 resulting in its decreased association with a de-ubiquitinating enzyme in glioblastoma cells. |
| 24001771 | DHHC17 is a ClipR-59 palmitoyltransferase that modulates ClipR-59 plasma membrane binding. |
| 22297296 | CLIPR-59 modulates ubiquitination of RIP1, resulting in the formation of Complex-II and thus promoting Caspase-8 activation to induce apoptosis by TNF-alpha. |
| 20052288 | CLIPR-59 may act as a typical chaperone, allowing a prompt interaction between tubulin and the raft component GD3 during cell apoptosis triggered by CD95/Fas |
| 18854154 | Knockdown of CAP-GLY domain containing linker protein 3 (CLIP3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1 |
| 15262990 | CLIPR-59 prevents microtubule-raft interactions |
| 11854307 | play an important role in membrane-microtubule interactions. |
MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEI 1 - 70 LFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAV 71 - 140 RLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLC 141 - 210 LGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNY 211 - 280 DNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPK 281 - 350 QGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGD 351 - 420 QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTD 421 - 490 SPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS 491 - 547 //
| PMID | Year | Title |
|---|---|---|
| 26198635 | 2015 | Identification of a Novel Sequence Motif Recognized by the Ankyrin Repeat Domain of zDHHC17/13 S-Acyltransferases. |
| 26017671 | 2015 | Spy1 induces de-ubiquitinating of RIP1 arrest and confers glioblastoma's resistance to tumor necrosis factor (TNF-?)-induced apoptosis through suppressing the association of CLIPR-59 and CYLD. |
| 24001771 | 2013 | DHHC17 palmitoylates ClipR-59 and modulates ClipR-59 association with the plasma membrane. |
| 22297296 | 2012 | CLIPR-59 regulates TNF-?-induced apoptosis by controlling ubiquitination of RIP1. |
| 20052288 | 2010 | Role of GD3-CLIPR-59 association in lymphoblastoid T cell apoptosis triggered by CD95/Fas. |
| 19139280 | 2009 | ClipR-59 interacts with Akt and regulates Akt cellular compartmentalization. |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| 15262990 | 2004 | CLIPR-59 is a lipid raft-associated protein containing a cytoskeleton-associated protein glycine-rich domain (CAP-Gly) that perturbs microtubule dynamics. |
| More... |
