Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.45
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 4.5e-05
atypical teratoid / rhabdoid tumor -1.200 4.2e-05
colon cancer -1.100 3.9e-03
ependymoma -1.500 5.9e-12
glioblastoma -1.500 2.7e-07
group 3 medulloblastoma -1.800 4.4e-05
lung carcinoma 1.400 4.3e-29
medulloblastoma, large-cell -2.400 3.5e-04
ovarian cancer -1.600 7.6e-11
Pick disease -1.400 8.4e-05
psoriasis -1.400 4.0e-04

Gene RIF (8)

AA Sequence

MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEI      1 - 70
LFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAV     71 - 140
RLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLC    141 - 210
LGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNY    211 - 280
DNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPK    281 - 350
QGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGD    351 - 420
QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTD    421 - 490
SPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS                 491 - 547
//

Text Mined References (15)

PMID Year Title