Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
R01 Count 5
Funding $371,639.4
PubMed Score 11.19
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.400 0.000
glioblastoma -1.500 0.000
posterior fossa group B ependymoma -1.900 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -2.400 0.000
colon cancer -1.100 0.004
adult high grade glioma -1.600 0.000
group 3 medulloblastoma -1.800 0.000
lung carcinoma 1.400 0.000
Pick disease -1.400 0.000
ovarian cancer -1.600 0.000

Gene RIF (7)

PMID Text
26017671 CLIPR-59 interacts with Spy1 resulting in its decreased association with a de-ubiquitinating enzyme in glioblastoma cells.
24001771 DHHC17 is a ClipR-59 palmitoyltransferase that modulates ClipR-59 plasma membrane binding.
22297296 CLIPR-59 modulates ubiquitination of RIP1, resulting in the formation of Complex-II and thus promoting Caspase-8 activation to induce apoptosis by TNF-alpha.
20052288 CLIPR-59 may act as a typical chaperone, allowing a prompt interaction between tubulin and the raft component GD3 during cell apoptosis triggered by CD95/Fas
18854154 Knockdown of CAP-GLY domain containing linker protein 3 (CLIP3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15262990 CLIPR-59 prevents microtubule-raft interactions
11854307 play an important role in membrane-microtubule interactions.

AA Sequence

MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEI      1 - 70
LFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAV     71 - 140
RLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLC    141 - 210
LGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNY    211 - 280
DNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPK    281 - 350
QGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGD    351 - 420
QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTD    421 - 490
SPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS                 491 - 547
//

Text Mined References (13)

PMID Year Title
26198635 2015 Identification of a Novel Sequence Motif Recognized by the Ankyrin Repeat Domain of zDHHC17/13 S-Acyltransferases.
26017671 2015 Spy1 induces de-ubiquitinating of RIP1 arrest and confers glioblastoma's resistance to tumor necrosis factor (TNF-?)-induced apoptosis through suppressing the association of CLIPR-59 and CYLD.
24001771 2013 DHHC17 palmitoylates ClipR-59 and modulates ClipR-59 association with the plasma membrane.
22297296 2012 CLIPR-59 regulates TNF-?-induced apoptosis by controlling ubiquitination of RIP1.
20052288 2010 Role of GD3-CLIPR-59 association in lymphoblastoid T cell apoptosis triggered by CD95/Fas.
19139280 2009 ClipR-59 interacts with Akt and regulates Akt cellular compartmentalization.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262990 2004 CLIPR-59 is a lipid raft-associated protein containing a cytoskeleton-associated protein glycine-rich domain (CAP-Gly) that perturbs microtubule dynamics.
More...