Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.58
PubTator Score 2.11

Knowledge Summary


No data available


  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.422 1.6e-02
adult high grade glioma 1.500 2.6e-03
Astrocytoma, Pilocytic 1.900 2.7e-06
cutaneous lupus erythematosus 3.800 6.5e-05
ependymoma 1.400 4.8e-05
glioblastoma 1.400 1.5e-05
hepatocellular carcinoma 1.400 5.4e-04
intraductal papillary-mucinous adenoma (... 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.700 8.8e-03
intraductal papillary-mucinous neoplasm ... 2.800 2.0e-03
juvenile dermatomyositis 1.440 6.0e-15
lung cancer -2.000 2.9e-04
malignant mesothelioma -1.100 1.5e-05
Multiple Sclerosis 1.600 4.3e-02
pancreatic cancer 1.400 3.9e-06
primary Sjogren syndrome 1.400 1.8e-04
psoriasis 1.300 7.9e-08


Accession Q96DX8 Q9H4F3
Symbols IFRG28


  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

GSGYEKLGPSRDPDPLNICVFILLLVFIVVKCFTSE                                      211 - 246

Text Mined References (7)

PMID Year Title