Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.24
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
juvenile dermatomyositis 1189 5.98180457929954E-15
pilocytic astrocytoma 3086 2.59151520393949E-6
pancreatic cancer 2300 3.87740376134149E-6
malignant mesothelioma 3163 1.54065938051718E-5
ependymoma 2514 4.82898918132073E-5
cutaneous lupus erythematosus 1056 6.54475810200372E-5
psoriasis 6685 7.56198385930246E-5
primary Sjogren syndrome 789 1.79877342773444E-4
lung cancer 4473 2.90545612741982E-4
hepatocellular carcinoma 550 5.41256239117434E-4
glioblastoma 5572 9.22043371143649E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00200428100040134
adult high grade glioma 2148 0.00256720397307726
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00884043396383096
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0106227436940548
active Crohn's disease 918 0.0164200434273157
Multiple Sclerosis 498 0.0434280975203809
Disease Target Count Z-score Confidence
Q fever 11 3.822 1.9
Endocarditis 18 3.094 1.5

Expression

Synonym

Accession Q96DX8 Q9H4F3
Symbols IFRG28
Z3CXXC4

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

AA Sequence

MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQRSWASAQVQIL      1 - 70
CHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVI     71 - 140
LEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAK    141 - 210
GSGYEKLGPSRDPDPLNICVFILLLVFIVVKCFTSE                                      211 - 246
//

Text Mined References (6)

PMID Year Title
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.