Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.24
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQRSWASAQVQIL      1 - 70
CHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVI     71 - 140
LEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAK    141 - 210
GSGYEKLGPSRDPDPLNICVFILLLVFIVVKCFTSE                                      211 - 246
//

Text Mined References (6)

PMID Year Title
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.