Property Summary

NCBI Gene PubMed Count 36
PubMed Score 67.89
PubTator Score 34.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.100 3.3e-02
adult high grade glioma 1.900 1.4e-03
atypical teratoid / rhabdoid tumor 1.600 4.4e-03
glioblastoma 1.300 2.0e-02
interstitial cystitis 1.600 6.6e-03
lung carcinoma -2.600 1.6e-19
medulloblastoma, large-cell 2.100 2.3e-05
mucosa-associated lymphoid tissue lympho... 1.045 1.7e-02
osteosarcoma -1.063 1.8e-02
ovarian cancer 1.700 3.3e-11
psoriasis 1.400 1.5e-41

Gene RIF (32)

AA Sequence

MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHET      1 - 70
KSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQ     71 - 140
LFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSA    141 - 210
QKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPT    211 - 280
NNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV                      281 - 332
//

Text Mined References (40)

PMID Year Title