Property Summary

NCBI Gene PubMed Count 33
Grant Count 69
R01 Count 28
Funding $9,852,460.36
PubMed Score 59.70
PubTator Score 34.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.063 0.018
atypical teratoid / rhabdoid tumor 1.600 0.004
glioblastoma 1.300 0.020
medulloblastoma, large-cell 2.100 0.000
interstitial cystitis 1.600 0.007
adult high grade glioma 1.900 0.001
lung carcinoma -2.600 0.000
mucosa-associated lymphoid tissue lympho... 1.045 0.017
acute myeloid leukemia 1.100 0.033
ovarian cancer 1.700 0.000
psoriasis 1.400 0.000

Synonym

Accession Q96DU3 A6NMW2 B2R8X8 Q14CF0 Q5TAS4 Q5TAS6 Q5TAT3 Q96DV0
Symbols KALI
NTBA
CD352
KALIb
Ly108
NTB-A
SF2000

Gene

PDB

2IF7  

Gene RIF (35)

PMID Text
26878112 In addition to their role in NK cell activation by hematopoietic cells, the SLAM-SAP-SHP1 pathways influence responsiveness toward nonhematopoietic targets by a process akin to NK cell 'education'.
26215564 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
26215564 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
25827531 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
25807049 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
24688028 our data reveal how SAP nucleates a previously unknown signaling complex involving NTB-A and LCK to potentiate restimulation-induced cell death of activated human T cells.
24036078 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
24035804 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
23528733 Together, these results suggest that the reduction of NTB-A from the cell surface is associated with the Vpu-mediated effect on the glycosylation pattern of newly synthesized NTB-A molecules.
23528733 HIV-1 (NL4-3) Vpu downregulates SLAMF6 via a cullin-RING E3 ubiquitin ligase complex- independent mechanism
More...

AA Sequence

MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHET      1 - 70
KSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQ     71 - 140
LFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSA    141 - 210
QKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPT    211 - 280
NNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV                      281 - 332
//

Text Mined References (37)

PMID Year Title
26878112 2016 A hematopoietic cell-driven mechanism involving SLAMF6 receptor, SAP adaptors and SHP-1 phosphatase regulates NK cell education.
24688028 2014 SAP facilitates recruitment and activation of LCK at NTB-A receptors during restimulation-induced cell death.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
23528733 2013 HIV-1 Vpu affects the anterograde transport and the glycosylation pattern of NTB-A.
22989874 2012 CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances ROR?t recruitment to the IL17A promoter in human T lymphocytes.
22184727 2012 Increased expression of SLAM receptors SLAMF3 and SLAMF6 in systemic lupus erythematosus T lymphocytes promotes Th17 differentiation.
21231893 2011 SLAMF6-driven co-stimulation of human peripheral T cells is defective in SLE T cells.
21075351 2010 Degranulation of natural killer cells following interaction with HIV-1-infected cells is hindered by downmodulation of NTB-A by Vpu.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...