Property Summary

NCBI Gene PubMed Count 6
PubMed Score 12.97
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.96750131666574E-8
ductal carcinoma in situ 1745 4.46051457105524E-4
osteosarcoma 7933 6.10462277609861E-4
breast carcinoma 1614 0.00258997904181532
invasive ductal carcinoma 2950 0.0187920028225867
fibroadenoma 557 0.0250512384021063

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.273 0.001
breast carcinoma -2.100 0.003
fibroadenoma -2.700 0.025
ductal carcinoma in situ -3.200 0.000
invasive ductal carcinoma -3.000 0.019
psoriasis -1.300 0.000

Synonym

Accession Q96DT0 B2R9N2 G5E970 Q96DS9 Q96PR9 Q9H258 Q9H259 Q9NZ02 Gal-12
Symbols GAL12
GRIP1

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Gene RIF (2)

PMID Text
25953264 Lower LGALS12 gene expression is associated with acute myeloid leukemia.
15131127 results suggest that mouse galectin-12 is a major regulator of adipose tissue development

AA Sequence

MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVP      1 - 70
LDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLF     71 - 140
GNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEV    141 - 210
PCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFL    211 - 280
FYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS                  281 - 336
//

Text Mined References (8)

PMID Year Title
25953264 2015 Expression profiling of cancer-related galectins in acute myeloid leukemia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131127 2004 Galectin-12 is required for adipogenic signaling and adipocyte differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435439 2001 Galectin-12, an Adipose-expressed Galectin-like Molecule Possessing Apoptosis-inducing Activity.
11283015 2001 Cell cycle regulation by galectin-12, a new member of the galectin superfamily.