Property Summary

NCBI Gene PubMed Count 6
Grant Count 6
R01 Count 5
Funding $1,040,035.5
PubMed Score 12.97
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.273 0.001
breast carcinoma -2.100 0.003
fibroadenoma -2.700 0.025
ductal carcinoma in situ -3.200 0.000
invasive ductal carcinoma -3.000 0.019
psoriasis -1.300 0.000

Gene RIF (2)

PMID Text
25953264 Lower LGALS12 gene expression is associated with acute myeloid leukemia.
15131127 results suggest that mouse galectin-12 is a major regulator of adipose tissue development

AA Sequence

MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVP      1 - 70
LDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLF     71 - 140
GNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEV    141 - 210
PCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFL    211 - 280
FYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS                  281 - 336
//

Text Mined References (8)

PMID Year Title
25953264 2015 Expression profiling of cancer-related galectins in acute myeloid leukemia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131127 2004 Galectin-12 is required for adipogenic signaling and adipocyte differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435439 2001 Galectin-12, an Adipose-expressed Galectin-like Molecule Possessing Apoptosis-inducing Activity.
11283015 2001 Cell cycle regulation by galectin-12, a new member of the galectin superfamily.