Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.66
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.0e-08
ductal carcinoma in situ 1745 4.5e-04
osteosarcoma 7950 6.1e-04
breast carcinoma 1638 2.6e-03
invasive ductal carcinoma 2951 1.9e-02
fibroadenoma 559 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -2.100 2.6e-03
ductal carcinoma in situ -3.200 4.5e-04
fibroadenoma -2.700 2.5e-02
invasive ductal carcinoma -3.000 1.9e-02
osteosarcoma -2.273 6.1e-04
psoriasis -1.300 7.0e-08

Synonym

Accession Q96DT0 B2R9N2 G5E970 Q96DS9 Q96PR9 Q9H258 Q9H259 Q9NZ02 Gal-12
Symbols GAL12
GRIP1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVP      1 - 70
LDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLF     71 - 140
GNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEV    141 - 210
PCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFL    211 - 280
FYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS                  281 - 336
//

Text Mined References (9)

PMID Year Title