Property Summary

NCBI Gene PubMed Count 12
Grant Count 15
Funding $496,357.68
PubMed Score 8.26
PubTator Score 8.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
24399467 A novel function of SGEF that excludes GEF.
23775076 Data indicate that the Src homology 3 domain-containing GEF (SGEF) promotes fibroblast growth factor-inducible 14 (Fn14) proinvasive signaling in glioblastoma via TNF receptor-associated factor 2 (TRAF2).
23661635 We report for the first time an SGEF function for RhoG that excludes GEF and the ability of SGEF to enhance EGFR stability and signaling by delaying its lysosomal sorting and degradation
22824926 SGEF is a novel promoter of human prostate cancer progression and development.
22383878 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
12697679 SGEF gene on chromosome 3q25.2. CSGEF expression controlled by androgen-responsive promoter of SGEF gene. SGEF may be regulator of Rho guanosine triphosphatases. CSGEF may function as regulator of Rho guanosine triphosphatase in prostate

AA Sequence

MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLLAAQIPAQVPT      1 - 70
ASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVPGGSPKSPANGAVTLPAPPP     71 - 140
PPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSS    141 - 210
SEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRS    211 - 280
MVEGLGGPLGHAGEESEVDNDVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMED    281 - 350
KEKFSSLGRIKKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ    351 - 420
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHHLFSNITDV    421 - 490
CEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRI    491 - 560
ESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERT    561 - 630
EMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEES    631 - 700
YNVNDYSLRDQLLVESCDNEELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSER    701 - 770
ARWITALGHSSGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF    771 - 840
PMECAKEITCQATIDKNVERMGRLLGLETNV                                           841 - 871
//

Text Mined References (20)

PMID Year Title
24399467 2014 Grb2 interacts with SGEF and antagonizes the ability of SGEF to enhance EGF-induced ERK1/2 activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775076 2013 The Src homology 3 domain-containing guanine nucleotide exchange factor is overexpressed in high-grade gliomas and promotes tumor necrosis factor-like weak inducer of apoptosis-fibroblast growth factor-inducible 14-induced cell migration and invasion via tumor necrosis factor receptor-associated factor 2.
23661635 2013 SGEF enhances EGFR stability through delayed EGFR trafficking from early to late endosomes.
22824926 2012 SGEF is overexpressed in prostate cancer and contributes to prostate cancer progression.
22383878 2012 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332407 2011 Comparative proteomic analysis of advanced serous epithelial ovarian carcinoma: possible predictors of chemoresistant disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...