Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.21
PubTator Score 8.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 4.8e-03
astrocytoma 1.100 4.1e-12
Astrocytoma, Pilocytic 1.300 6.7e-06
Atopic dermatitis -1.100 1.0e-03
Breast cancer 2.600 3.8e-02
chronic rhinosinusitis -1.294 2.8e-03
colon cancer -1.200 1.5e-02
cutaneous lupus erythematosus -1.600 4.7e-05
ependymoma 1.500 6.8e-09
glioblastoma 1.100 1.4e-02
group 3 medulloblastoma -1.600 1.1e-03
intraductal papillary-mucinous adenoma (... -1.500 4.5e-03
intraductal papillary-mucinous neoplasm ... -2.600 1.7e-03
lung adenocarcinoma -2.000 5.4e-15
lung cancer -1.500 1.7e-02
lung carcinoma -1.500 1.9e-13
malignant mesothelioma -2.700 1.1e-07
medulloblastoma, large-cell -3.500 1.0e-06
non-small cell lung cancer -1.041 2.8e-14
oligodendroglioma 2.200 8.2e-03
ovarian cancer -1.900 3.8e-12
pancreatic ductal adenocarcinoma liver m... -2.507 6.1e-04
pituitary cancer -1.600 2.8e-03
psoriasis -2.000 3.4e-05

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLLAAQIPAQVPT      1 - 70
ASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVPGGSPKSPANGAVTLPAPPP     71 - 140
PPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSS    141 - 210
SEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRS    211 - 280
MVEGLGGPLGHAGEESEVDNDVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMED    281 - 350
KEKFSSLGRIKKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ    351 - 420
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHHLFSNITDV    421 - 490
CEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRI    491 - 560
ESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERT    561 - 630
EMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEES    631 - 700
YNVNDYSLRDQLLVESCDNEELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSER    701 - 770
ARWITALGHSSGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF    771 - 840
PMECAKEITCQATIDKNVERMGRLLGLETNV                                           841 - 871
//

Text Mined References (23)

PMID Year Title