Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.88
PubTator Score 9.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.159 0.001
breast carcinoma -1.500 0.000
fibroadenoma -1.400 0.023

Gene RIF (6)

PMID Text
26522362 URG11 could promote hepatocellular carcinoma (HCC) cell growth and proliferation. It might play an important role in HCC development.
24930007 Up-regulation of URG11 in pancreatic cancer leads to enhancing epithelial-mesenchymal transition-driven invasion and thus lead to poor prognosis.
23828164 Increased expression of both URG11 was associated with decrease renal function in IgA nephropathy.
19900406 URG11 mediates hypoxia-induced epithelial-to-mesenchymal transition through the suppression of E-cadherin and the activation of the beta-catenin/T-cell factor pathway.
19413886 Data suggest that URG11 contributes to gastric cancer growth and metastasis at least partially through activation of beta-catenin signalling pathway.
16496348 beta-catenin is activated by HBxAg, in part, through the upregulated expression of the HBxAg effector URG11; URG11 stimulates the beta-catenin promoter and hepatocellular growth and survival

AA Sequence

MWAGLLLRAACVALLLPGAPARGYTGRKPPGHFAAERRRLGPHVCLSGFGSGCCPGWAPSMGGGHCTLPL      1 - 70
CSFGCGSGICIAPNVCSCQDGEQGATCPETHGPCGEYGCDLTCNHGGCQEVARVCPVGFSMTETAVGIRC     71 - 140
TDIDECVTSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQDTDECLGTPCQQRCKNSIGSYKCSCRTGFH    141 - 210
LHGNRHSCVDVNECRRPLERRVCHHSCHNTVGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPRQH    211 - 280
PSKMLLLLPEAGRPALSPGHSPPSGAPGPPAGVRTTRLPSPTPRLPTSSPSAPVWLLSTLLATPVPTASL    281 - 350
LGNLRPPSLLQGEVMGTPSSPRGPESPRLAAGPSPCWHLGAMHESRSRWTEPGCSQCWCEDGKVTCEKVR    351 - 420
CEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQ    421 - 490
TDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQ    491 - 560
EPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCPHPIRIPGQCCPDCSAGCT    561 - 630
YTGRIFYNNETFPSVLDPCLSCICLLGSVACSPVDCPITCTYPFHPDGECCPVCRDCNYEGRKVANGQVF    631 - 700
TLDDEPCTRCTCQLGEVSCEKVPCQRACADPALLPGDCCSSCPDSLSPLEEKQGLSPHGNVAFSKAGRSL    701 - 770
HGDTEAPVNCSSCPGPPTASPSRPVLHLLQLLLRTNLMKTQTLPTSPAGAHGPHSLALGLTATFPGEPGA    771 - 840
SPRLSPGPSTPPGAPTLPLASPGAPQPPPVTPERSFSASGAQIVSRWPPLPGTLLTEASALSMMDPSPSK    841 - 910
TPITLLGPRVLSPTTSRLSTALAATTHPGPQQPPVGASRGEESTM                             911 - 955
//

Text Mined References (12)

PMID Year Title
26522362 2015 [Increased expression URG11 in hepatocellular carcinoma tissues promotes the growth of hepatocellular carcinoma cells].
24930007 2014 URG11 predicts poor prognosis of pancreatic cancer by enhancing epithelial-mesenchymal transition-driven invasion.
23828164 2013 Association of URG11 and Twist with clinical pathological characteristics and prognosis in patients with IgA nephropathy.
19900406 2010 URG11 mediates hypoxia-induced epithelial-to-mesenchymal transition by modulation of E-cadherin and beta-catenin.
19413886 2010 URG11 promotes gastric cancer growth and invasion by activation of beta-catenin signalling pathway.
16496348 2006 Enhanced cell survival of Hep3B cells by the hepatitis B x antigen effector, URG11, is associated with upregulation of beta-catenin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12869306 Upregulated expression of a unique gene by hepatitis B x antigen promotes hepatocellular growth and tumorigenesis.
More...