Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.13
PubTator Score 301.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.88570522217846E-12
ependymoma 2514 2.13605085137652E-8
pediatric high grade glioma 2712 9.75376290079668E-7
pilocytic astrocytoma 3086 2.25488878689294E-5
atypical teratoid / rhabdoid tumor 4369 2.6801718168903E-5
ovarian cancer 8492 5.81683819152622E-5
osteosarcoma 7933 5.42486497268125E-4
medulloblastoma, large-cell 6234 7.43456623433476E-4
glioblastoma 5572 0.00251466883729796
hereditary spastic paraplegia 313 0.00322553090188903
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00490974653758233
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00501728454762096
subependymal giant cell astrocytoma 2287 0.0139541171662036
progressive supranuclear palsy 674 0.0150768987724275
aldosterone-producing adenoma 664 0.0182730945674819

Expression

Synonym

Accession Q96DB5 A9UMZ8 B4DNF5 B4DZW6 B5MC61 C9JSC6 E7EVI2 Q9Y398 RMD-1
Symbols RMD1
RMD-1
CGI-90
FAM82B

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQV      1 - 70
ISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKK     71 - 140
LLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL    141 - 210
MGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAA    211 - 280
FWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN                                        281 - 314
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18070910 2007 RMD-1, a novel microtubule-associated protein, functions in chromosome segregation in Caenorhabditis elegans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...