Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.13
PubTator Score 301.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (2)

AA Sequence

MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQV      1 - 70
ISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKK     71 - 140
LLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL    141 - 210
MGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAA    211 - 280
FWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN                                        281 - 314
//

Text Mined References (13)

PMID Year Title