Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.94
PubTator Score 8.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Schizophrenia 1160 3.148 1.6
Bipolar Disorder 666 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.1e-11
ependymoma 4679 1.4e-06
tuberculosis 2010 1.5e-06
primitive neuroectodermal tumor 3035 2.0e-06
glioblastoma 5792 2.2e-05
adult high grade glioma 3801 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.2
Disease Target Count Z-score Confidence
Rett syndrome 18 3.751 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.600 1.2e-03
ependymoma -1.900 1.4e-06
glioblastoma -1.600 2.2e-05
osteosarcoma -5.765 1.1e-11
primitive neuroectodermal tumor -2.300 2.0e-06
tuberculosis 1.800 1.5e-06

Gene RIF (6)

AA Sequence

MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCS      1 - 70
HENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMT     71 - 140
FEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKH    141 - 210
VRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISN    211 - 280
IEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSF    281 - 350
GNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR    351 - 420
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPR    421 - 490
CDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR                                  491 - 530
//

Text Mined References (19)

PMID Year Title