Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.18
PubTator Score 8.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -2.200 0.000
osteosarcoma -5.765 0.000
ependymoma -1.900 0.000
primitive neuroectodermal tumor -2.300 0.000
tuberculosis 1.800 0.000
pediatric high grade glioma -1.700 0.000

Synonym

Accession Q96CW9 Q5JUJ2 Q6UXY0 Q96JH0
Symbols Lmnt2
NTNG1
LHLL9381
bA479K20.1

Gene

PDB

3ZYI   3TBD   3ZYG  

Gene RIF (6)

PMID Text
22957104 presence of Gng2 and Netrin-G2 immunoreactive elements in the insular cortex, but not in the putamen, suggests a possible common ontogeny of the claustrum and insula
22041449 the crystal structure for a fragment comprising the LN domain and domain LE1 of netrin G2 by sulfur single-wavelength anomalous diffraction phasing and refined it to 1.8 A resolution was determined.
20382146 Netrin-g2 is involved in the pathophysiology of epilepsy and are consistent with the hypothesis that this protein may participate in the abnormal development of synapses and in neuron migration
20029409 Observational study of gene-disease association. (HuGE Navigator)
17507910 The data of this stusty implicate NTNG2 in the pathophysiology of schizophrenia and bipolar disorder, but do not support the hypothesis that altered mRNA expression is the mechanism by which genetic variation of NTNG2 may confer disease susceptibility.
15705354 An association between NTNG2 and schizophrenia was observed with SNPs and haplotypes that clustered in the 5' region of the gene.

AA Sequence

MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCS      1 - 70
HENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMT     71 - 140
FEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKH    141 - 210
VRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISN    211 - 280
IEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSF    281 - 350
GNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR    351 - 420
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPR    421 - 490
CDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR                                  491 - 530
//

Text Mined References (18)

PMID Year Title
22957104 2012 Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
22041449 2011 Crystal structure of the ligand binding domain of netrin G2.
21946559 2011 Structural basis for cell surface patterning through NetrinG-NGL interactions.
20382146 2010 Abnormal expression of netrin-G2 in temporal lobe epilepsy neurons in humans and a rat model.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
17507910 2008 Decreased mRNA expression of netrin-G1 and netrin-G2 in the temporal lobe in schizophrenia and bipolar disorder.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15705354 2005 A family-based association study and gene expression analyses of netrin-G1 and -G2 genes in schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...