Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.34
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.0e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.749 1.0e-06

Gene RIF (1)

AA Sequence

MEAARTAVLRVKRKRSAEPAEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQP      1 - 70
LLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLSSRRSLGTTSSGQESEYTPGNPEAAGNSGFQLLD     71 - 140
LVHEEGEPEAASAGSCKTSDPDVILCNSVELIRERLTVSEDGPGVRRQEEQKHDDYVYDIYYLETATPGW    141 - 210
IENILSVQPYSQEWELVNDDQEPEDIYDDEDDENSENNWRNEYPEEESSDGDEDSRGSADYNSLSEEERG    211 - 280
SSRQRMWSKYPLDVQKEFGYDSPHDLDSD                                             281 - 309
//

Text Mined References (17)

PMID Year Title