Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.272 7.0e-03
acute quadriplegic myopathy 1.214 1.3e-09
adrenocortical carcinoma -2.416 9.1e-06
adult high grade glioma -1.700 3.3e-05
astrocytic glioma -1.900 4.9e-03
Astrocytoma, Pilocytic -2.300 2.7e-10
atypical teratoid / rhabdoid tumor -1.200 2.1e-02
Breast cancer -1.200 6.6e-61
breast carcinoma -1.900 2.3e-06
ductal carcinoma in situ -1.700 9.2e-05
ependymoma -1.200 2.0e-04
gastric carcinoma 2.600 1.7e-02
glioblastoma -1.300 2.8e-05
group 3 medulloblastoma 1.700 2.1e-04
invasive ductal carcinoma -2.800 2.5e-05
medulloblastoma, large-cell 1.300 3.9e-04
oligodendroglioma -1.300 3.8e-02
ovarian cancer 1.600 1.5e-05
pituitary cancer -1.600 4.9e-04
ulcerative colitis 1.700 1.3e-07

Protein-protein Interaction (6)

Gene RIF (6)

AA Sequence

MSRHHSRFERDYRVGWDRREWSVNGTHGTTSICSVTSGAGGGTASSLSVRPGLLPLPVVPSRLPTPATAP      1 - 70
APCTTGSSEAITSLVASSASAVTTKAPGISKGDSQSQGLATSIRWGQTPINQSTPWDTDEPPSKQMRESD     71 - 140
NPGTGPWVTTVAAGNQPTLIAHSYGVAQPPTFSPAVNVQAPVIGVTPSLPPHVGPQLPLMPGHYSLPQPP    141 - 210
SQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPA    211 - 280
TNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASC    281 - 350
SLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC    351 - 420
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLN    421 - 490
TKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYH    491 - 560
MLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFS    561 - 630
VVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHV    631 - 700
ERYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKY    701 - 770
APAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM    771 - 840
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG                                       841 - 875
//

Text Mined References (16)

PMID Year Title