Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Hypertensive disease 193
Disease Target Count P-value
Breast cancer 3099 7.43629437675202E-41
pilocytic astrocytoma 3086 6.50972227151351E-11
acute quadriplegic myopathy 1157 1.26061521728594E-9
posterior fossa group A ependymoma 1511 1.00293369572875E-7
ulcerative colitis 2087 1.30412105810587E-7
breast carcinoma 1614 2.33584054777752E-6
adrenocortical carcinoma 1427 9.08359243042246E-6
ovarian cancer 8492 1.53235473870531E-5
invasive ductal carcinoma 2950 2.47896026187557E-5
adult high grade glioma 2148 3.34942704876055E-5
ductal carcinoma in situ 1745 9.21534674428229E-5
group 3 medulloblastoma 2254 2.11858078693225E-4
glioblastoma 5572 3.02203229881784E-4
medulloblastoma, large-cell 6234 3.91172778446828E-4
pituitary cancer 1972 0.00132190674864859
astrocytic glioma 2241 0.00494781641954118
active Crohn's disease 918 0.0069750389057721
gastric carcinoma 832 0.016624994025769
atypical teratoid / rhabdoid tumor 4369 0.0213902125164435
oligodendroglioma 2849 0.0384123923990537
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Multiple Sclerosis 498 0.0 2.0

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.900 0.005
oligodendroglioma -1.300 0.038
posterior fossa group A ependymoma -1.400 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.200 0.021
medulloblastoma, large-cell 1.300 0.000
acute quadriplegic myopathy 1.214 0.000
adrenocortical carcinoma -2.416 0.000
active Crohn's disease 1.272 0.007
breast carcinoma -1.900 0.000
adult high grade glioma -1.700 0.000
group 3 medulloblastoma 1.700 0.000
pilocytic astrocytoma -2.300 0.000
Breast cancer -3.500 0.000
gastric carcinoma 2.600 0.017
ductal carcinoma in situ -1.700 0.000
invasive ductal carcinoma -2.800 0.000
ulcerative colitis 1.700 0.000
ovarian cancer 1.600 0.000
pituitary cancer -2.000 0.001

Synonym

Accession Q96CT2 Q8N388 Q96BF0 Q96PW7
Symbols KBTBD9

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRHHSRFERDYRVGWDRREWSVNGTHGTTSICSVTSGAGGGTASSLSVRPGLLPLPVVPSRLPTPATAP      1 - 70
APCTTGSSEAITSLVASSASAVTTKAPGISKGDSQSQGLATSIRWGQTPINQSTPWDTDEPPSKQMRESD     71 - 140
NPGTGPWVTTVAAGNQPTLIAHSYGVAQPPTFSPAVNVQAPVIGVTPSLPPHVGPQLPLMPGHYSLPQPP    141 - 210
SQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPA    211 - 280
TNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASC    281 - 350
SLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC    351 - 420
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLN    421 - 490
TKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYH    491 - 560
MLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFS    561 - 630
VVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHV    631 - 700
ERYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKY    701 - 770
APAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM    771 - 840
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG                                       841 - 875
//

Text Mined References (14)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...