Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.59
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.4e-03
non primary Sjogren syndrome sicca 1.200 1.1e-02
osteosarcoma -1.384 6.1e-06
primitive neuroectodermal tumor 1.100 1.3e-04

Gene RIF (3)

AA Sequence

MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGALGC      1 - 70
AGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRL     71 - 140
IPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPDCGRRFSYPSLLVSHRRAHSGECPYVCDQC    141 - 210
GKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQ    211 - 280
RTHTGEKPYTCLECNRRFRQRTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHC    281 - 350
EARFSQRSTLLQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR    351 - 420
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPKAPNCSPRSAI    421 - 490
GGSSQRGNAH                                                                491 - 500
//

Text Mined References (9)

PMID Year Title