Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.59
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.384 0.000
primitive neuroectodermal tumor 1.100 0.000
group 3 medulloblastoma 1.100 0.001
non primary Sjogren syndrome sicca 1.200 0.011

Gene RIF (3)

PMID Text
21624362 The results indicate that ZNF689 blocks pro-apoptotic signaling by suppressing the Bak/Bax/Bid pathway, resulting in the progression of liver cancer and resistance to 5-FU. ZNF689 may be a promising chemotherapeutic target against liver cancer.
16568080 overexpressed TIPUH1 may play a role in hepatocarcinogenesis by regulating transcription and/or RNA processing of growth control genes
16568080 TIPUH1 conferred anchorage independent growth and its knockdown in HCCs resulted in their growth inhibition. Interacts with TIF1beta, hnRNPU, hnRNPF, Nucleolin. May play a role in hepatocarcinogenesis by regulating transcription and/or RNA processing.

AA Sequence

MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGALGC      1 - 70
AGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRL     71 - 140
IPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPDCGRRFSYPSLLVSHRRAHSGECPYVCDQC    141 - 210
GKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQ    211 - 280
RTHTGEKPYTCLECNRRFRQRTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHC    281 - 350
EARFSQRSTLLQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR    351 - 420
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPKAPNCSPRSAI    421 - 490
GGSSQRGNAH                                                                491 - 500
//

Text Mined References (8)

PMID Year Title
21624362 2011 ZNF689 suppresses apoptosis of hepatocellular carcinoma cells through the down-regulation of Bcl-2 family members.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16568080 2006 TIPUH1 encodes a novel KRAB zinc-finger protein highly expressed in human hepatocellular carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.