Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.59
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.09698796736179E-6
primitive neuroectodermal tumor 3031 1.25407755647047E-4
group 3 medulloblastoma 2254 0.00141761170732063
non primary Sjogren syndrome sicca 840 0.0113822478223754
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.384 0.000
primitive neuroectodermal tumor 1.100 0.000
group 3 medulloblastoma 1.100 0.001
non primary Sjogren syndrome sicca 1.200 0.011

Synonym

Accession Q96CS4 Q658J5
Symbols TIPUH1

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
21624362 The results indicate that ZNF689 blocks pro-apoptotic signaling by suppressing the Bak/Bax/Bid pathway, resulting in the progression of liver cancer and resistance to 5-FU. ZNF689 may be a promising chemotherapeutic target against liver cancer.
16568080 overexpressed TIPUH1 may play a role in hepatocarcinogenesis by regulating transcription and/or RNA processing of growth control genes
16568080 TIPUH1 conferred anchorage independent growth and its knockdown in HCCs resulted in their growth inhibition. Interacts with TIF1beta, hnRNPU, hnRNPF, Nucleolin. May play a role in hepatocarcinogenesis by regulating transcription and/or RNA processing.

AA Sequence

MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGALGC      1 - 70
AGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRL     71 - 140
IPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPDCGRRFSYPSLLVSHRRAHSGECPYVCDQC    141 - 210
GKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQ    211 - 280
RTHTGEKPYTCLECNRRFRQRTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHC    281 - 350
EARFSQRSTLLQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR    351 - 420
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPKAPNCSPRSAI    421 - 490
GGSSQRGNAH                                                                491 - 500
//

Text Mined References (8)

PMID Year Title
21624362 2011 ZNF689 suppresses apoptosis of hepatocellular carcinoma cells through the down-regulation of Bcl-2 family members.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16568080 2006 TIPUH1 encodes a novel KRAB zinc-finger protein highly expressed in human hepatocellular carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.