Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.800 3.8e-12
ductal carcinoma in situ 1.800 4.1e-03
group 3 medulloblastoma -1.200 2.7e-04
intraductal papillary-mucinous adenoma (... 1.300 8.7e-05
invasive ductal carcinoma 1.900 7.0e-03
non-small cell lung cancer 1.333 1.9e-11
ovarian cancer 1.600 2.5e-06
psoriasis -1.100 7.8e-36

AA Sequence

MPRLLHPALPLLLGATLTFRALRRALCRLPLPVHVRADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTP      1 - 70
DMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVL     71 - 140
TLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGI    141 - 210
LLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE                                     211 - 247
//

Text Mined References (5)

PMID Year Title