Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.54
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 2.1e-09
sonic hedgehog group medulloblastoma 467 3.4e-05
adult high grade glioma 3801 1.8e-04
osteosarcoma 7950 1.9e-04
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 1.1
Disease Target Count Z-score Confidence
Holoprosencephaly 56 3.609 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-04
ependymoma -1.200 2.1e-09
osteosarcoma 1.356 1.9e-04
sonic hedgehog group medulloblastoma -1.500 3.4e-05

Synonym

Accession Q96CN4 B9A6I9
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASPTLSPDSSSQEALSAPTCSPTSDSENLSPDELELLAKLEEQNRLLEADSKSMRSMNGSRRNSGSSLV      1 - 70
SSSSASSNLSHLEEDTWILWGRIANEWEEWRRRKEKLLKELIRKGIPHHFRAIVWQLLCSATDMPVKNQY     71 - 140
SELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQM    141 - 210
PEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLF    211 - 280
LTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQAELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKA    281 - 350
YQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKGQVTRAQEAEENYVIKRELA    351 - 420
VVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTEDFVSHLETELEQSRLRETETLGALREMQDKVLDMEK    421 - 490
RNSSLPDENNVAQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGRWKESPRKLVVGELQD    491 - 560
ELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRR    561 - 630
KQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELK    631 - 700
AEVRLLKGPPPFEDPLAFDGLSLARHLDEDSLPSSDEELLGVGVGAALQDALYPLSPRDARFFRRLERPA    701 - 770
KDSEGSSDSDADELAAPYSQGLDN                                                  771 - 794
//

Text Mined References (16)

PMID Year Title