Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.54
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.356 0.000
posterior fossa group B ependymoma -1.300 0.000
adult high grade glioma -1.200 0.000
sonic hedgehog group medulloblastoma -1.500 0.000

AA Sequence

MASPTLSPDSSSQEALSAPTCSPTSDSENLSPDELELLAKLEEQNRLLEADSKSMRSMNGSRRNSGSSLV      1 - 70
SSSSASSNLSHLEEDTWILWGRIANEWEEWRRRKEKLLKELIRKGIPHHFRAIVWQLLCSATDMPVKNQY     71 - 140
SELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQM    141 - 210
PEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLF    211 - 280
LTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQAELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKA    281 - 350
YQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKGQVTRAQEAEENYVIKRELA    351 - 420
VVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTEDFVSHLETELEQSRLRETETLGALREMQDKVLDMEK    421 - 490
RNSSLPDENNVAQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGRWKESPRKLVVGELQD    491 - 560
ELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRR    561 - 630
KQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELK    631 - 700
AEVRLLKGPPPFEDPLAFDGLSLARHLDEDSLPSSDEELLGVGVGAALQDALYPLSPRDARFFRRLERPA    701 - 770
KDSEGSSDSDADELAAPYSQGLDN                                                  771 - 794
//

Text Mined References (14)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23669355 2013 The Evi5 family in cellular physiology and pathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20205591 2010 Host determinants of HIV-1 control in African Americans.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
19060904 2009 An empirical framework for binary interactome mapping.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16923123 2006 Screening for target Rabs of TBC (Tre-2/Bub2/Cdc16) domain-containing proteins based on their Rab-binding activity.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...