Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.43
PubTator Score 2.63

Knowledge Summary

Patent (1,492)

Expression

  Differential Expression (12)

Disease log2 FC p
breast carcinoma -1.100 2.7e-04
ductal carcinoma in situ -2.600 3.2e-05
fibroadenoma -1.100 4.1e-02
intraductal papillary-mucinous carcinoma... -1.100 2.0e-03
invasive ductal carcinoma -3.400 1.2e-04
lung adenocarcinoma -1.300 1.9e-15
lung carcinoma -1.600 7.8e-10
mucosa-associated lymphoid tissue lympho... 1.218 1.0e-02
non-small cell lung cancer -2.015 2.8e-27
osteosarcoma -4.602 4.8e-06
pancreatic ductal adenocarcinoma liver m... -1.629 9.1e-03
psoriasis -1.400 6.6e-11

Gene RIF (1)

AA Sequence

MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMA      1 - 70
VAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMAS     71 - 140
VYNTRHVCGFVWGGALLTSFSSLLFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALATLYALVLL    141 - 210
SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDF    211 - 280
SKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA                     281 - 333
//

Text Mined References (7)

PMID Year Title