Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.63
PubTator Score 2.63

Knowledge Summary

Patent (1,492)

Expression

  Differential Expression (12)

Gene RIF (1)

PMID Text
23980258 Knockdown of GPR146 blocked C-peptide-induced cFos expression in KATOIII cells.

AA Sequence

MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMA      1 - 70
VAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMAS     71 - 140
VYNTRHVCGFVWGGALLTSFSSLLFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALATLYALVLL    141 - 210
SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDF    211 - 280
SKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA                     281 - 333
//

Text Mined References (7)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23980258 2013 Evidence for an interaction between proinsulin C-peptide and GPR146.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.