Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.63
PubTator Score 2.63

Knowledge Summary

Patent (1,492)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.76551311960658E-27
lung adenocarcinoma 2714 3.80344061516728E-23
psoriasis 6685 6.58679201737105E-11
lung carcinoma 2844 7.80962630415445E-10
osteosarcoma 7933 4.76502772519742E-6
ductal carcinoma in situ 1745 3.24257095587953E-5
invasive ductal carcinoma 2950 1.17772357661663E-4
breast carcinoma 1614 2.65232388635825E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00198277064625821
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00911561163657531
mucosa-associated lymphoid tissue lymphoma 480 0.0102974988690323
fibroadenoma 557 0.0405725242952523

Expression

  Differential Expression (12)

Synonym

Accession Q96CH1 Q86SP5
Symbols PGR8

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model
Steve Finkbeiner Neurite phenotype identified

Gene RIF (1)

PMID Text
23980258 Knockdown of GPR146 blocked C-peptide-induced cFos expression in KATOIII cells.

AA Sequence

MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMA      1 - 70
VAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMAS     71 - 140
VYNTRHVCGFVWGGALLTSFSSLLFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALATLYALVLL    141 - 210
SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDF    211 - 280
SKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA                     281 - 333
//

Text Mined References (7)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23980258 2013 Evidence for an interaction between proinsulin C-peptide and GPR146.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.