Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
R01 Count 4
Funding $182,079
PubMed Score 23.55
PubTator Score 11.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.600 0.000
glioblastoma 1.100 0.000
pancreatic ductal adenocarcinoma liver m... 1.272 0.045
active ulcerative colitis 1.694 0.011
pilocytic astrocytoma 1.600 0.000

Synonym

Accession Q96CC6 Q04842 Q1W6H2 Q4TT59 Q96S34 Q9H6E1 iRhom1
Symbols Dist1
hDist1
C16orf8
EGFR-RS
gene-89
gene-90

Gene

PANTHER Protein Class (3)

Pathway (1)

Gene RIF (8)

PMID Text
26535007 results explain how loss of the amino terminus in iRhom1 and iRhom2 impairs TNF signaling, despite enhancing ADAM17 activity
26109405 The expression of iRhom1 was increased by endoplasmic reticulum (ER) stressors, such as thapsigargin and tunicamycin, leading to the enhancement of proteasome activity, especially in ER-containing microsomes.
24648344 RHBDF1 is a critical component of a molecular switch that regulates HIF1alpha stability in cancer cells in hypoxia.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18832597 RHBDF1 is critically involved in a G protein-coupled receptors ligand-stimulated process leading to the activation of latent epidermal growth factor receptor ligands
18524845 RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
15965977 RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface

AA Sequence

MSEARRDSTSSLQRKKPPWLKLDIPSAVPLTAEEPSFLQPLRRQAFLRSVSMPAETAHISSPHHELRRPV      1 - 70
LQRQTSITQTIRRGTADWFGVSKDSDSTQKWQRKSIRHCSQRYGKLKPQVLRELDLPSQDNVSLTSTETP     71 - 140
PPLYVGPCQLGMQKIIDPLARGRAFRVADDTAEGLSAPHTPVTPGAASLCSFSSSRSGFHRLPRRRKRES    141 - 210
VAKMSFRAAAALMKGRSVRDGTFRRAQRRSFTPASFLEEDTTDFPDELDTSFFAREGILHEELSTYPDEV    211 - 280
FESPSEAALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVRLRQEVVSTAGP    281 - 350
RRGQRIAVPVRKLFAREKRPYGLGMVGRLTNRTYRKRIDSFVKRQIEDMDDHRPFFTYWLTFVHSLVTIL    351 - 420
AVCIYGIAPVGFSQHETVDSVLRNRGVYENVKYVQQENFWIGPSSEALIHLGAKFSPCMRQDPQVHSFIR    421 - 490
SAREREKHSACCVRNDRSGCVQTSEEECSSTLAVWVKWPIHPSAPELAGHKRQFGSVCHQDPRVCDEPSS    491 - 560
EDPHEWPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCS    561 - 630
QVHCMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSG    631 - 700
VTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNF    701 - 770
AHISGFISGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVVLFYVYPVRCEWCEFLTCIPF    771 - 840
TDKFCEKYELDAQLH                                                           841 - 855
//

Text Mined References (20)

PMID Year Title
26535007 2015 Deletions in the cytoplasmic domain of iRhom1 and iRhom2 promote shedding of the TNF receptor by the protease ADAM17.
26109405 2015 iRhom1 regulates proteasome activity via PAC1/2 under ER stress.
24648344 2014 Human rhomboid family-1 suppresses oxygen-independent degradation of hypoxia-inducible factor-1? in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21439629 2011 Rhomboid family pseudoproteases use the ER quality control machinery to regulate intercellular signaling.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18832597 2009 Human rhomboid family-1 gene RHBDF1 participates in GPCR-mediated transactivation of EGFR growth signals in head and neck squamous cancer cells.
18524845 2008 Human rhomboid family-1 gene silencing causes apoptosis or autophagy to epithelial cancer cells and inhibits xenograft tumor growth.
16728641 2006 A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.
More...