Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.49
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.4e-06
ovarian cancer 8520 1.2e-03
medulloblastoma, large-cell 6241 3.4e-03
astrocytic glioma 2597 1.8e-02

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
medulloblastoma, large-cell -1.300 3.4e-03
osteosarcoma -2.213 9.4e-06
ovarian cancer 1.200 1.2e-03

AA Sequence

MAAVEAAAEPVTVVAAVGPKAKDEEEEEEEPLPPCEAVRWAPVGAVAEARPGATAFLEEATAEEPGAAPG      1 - 70
SPPDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGY     71 - 140
EGPGDPASDEGDGLPGDRPWLRGEDQSEQEKQERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLP    141 - 210
QSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMF    211 - 280
INFIQDEVGSPLQTGGGHCECKAGGKTGNGCSRTGSSRTPPGNSKTKAEDVKKVRETGLHLMRRALAVLQ    281 - 350
IFAVSQFGCATGQIPPTLWQRVQADRDYSPLLKRLEVSVDRVKQLALRQQPHDHVITSANLQDLSLGGKD    351 - 420
ELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYYHAKNGRAYVE    421 - 490
SPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICK    491 - 560
SGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDAF                     561 - 613
//

Text Mined References (13)

PMID Year Title