Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.300 4.4e-04
atypical teratoid / rhabdoid tumor -1.100 2.3e-04
medulloblastoma, large-cell -1.100 7.7e-04
osteosarcoma -1.234 1.4e-06

AA Sequence

MNILPKKSWHVRNKDNVARVRRDEAQAREEEKERERRVLLAQQEARTEFLRKKARHQNSLPELEAAEAGA      1 - 70
PGSGPVDLFRELLEEGKGVIRGNKEYEEEKRQEKERQEKALGILTYLGQSAAEAQTQPPWYQLPPGRGGP     71 - 140
PPGPAPDEKIKSRLDPLREMQKHLGKKRQHGGDEGSRSRKEKEGSEKQRPKEPPSLDQLRAERLRREAAE    141 - 210
RSRAEALLARVQGRALQEGQPEEDETDDRRRRYNSQFNPQLARRPRQQDPHLTH                    211 - 264
//

Text Mined References (10)

PMID Year Title