Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.35363279336112E-7
osteosarcoma 7933 3.12820206498672E-6
medulloblastoma, large-cell 6234 7.06502070641078E-5
group 3 medulloblastoma 2254 0.0011749750094422
active Crohn's disease 918 0.0346205573954444
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 3.322 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.633 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
active Crohn's disease -1.041 0.035
group 3 medulloblastoma 1.300 0.001

Synonym

Accession Q96BV0 Q8IY24
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid

AA Sequence

MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESG      1 - 70
SPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWSSLKIHQRTHTGEKPYLCGKC     71 - 140
GKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLKHQKTHSRPATHSCPECERCFRHQVGLRIHQ    141 - 210
RAHARDRQGSRAGLHELIQDAAARRACRLQPGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQ    211 - 280
FICNECGKSFTWWSSLNIHQRIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQ    281 - 350
HLLKHLRTHLPGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQ    351 - 420
RSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECGRRFSQKPNLT    421 - 490
RHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR                           491 - 537
//

Text Mined References (3)

PMID Year Title
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.