Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -1.041 3.5e-02
atypical teratoid / rhabdoid tumor -1.100 3.4e-07
group 3 medulloblastoma 1.300 1.2e-03
medulloblastoma, large-cell -1.100 7.1e-05
osteosarcoma -1.633 3.1e-06

AA Sequence

MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESG      1 - 70
SPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWSSLKIHQRTHTGEKPYLCGKC     71 - 140
GKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLKHQKTHSRPATHSCPECERCFRHQVGLRIHQ    141 - 210
RAHARDRQGSRAGLHELIQDAAARRACRLQPGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQ    211 - 280
FICNECGKSFTWWSSLNIHQRIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQ    281 - 350
HLLKHLRTHLPGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQ    351 - 420
RSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECGRRFSQKPNLT    421 - 490
RHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR                           491 - 537
//

Text Mined References (4)

PMID Year Title