Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 0.039
osteosarcoma -1.821 0.000
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.300 0.002
glioblastoma -1.500 0.003
medulloblastoma -1.300 0.004
medulloblastoma, large-cell -2.600 0.000
adult high grade glioma -1.400 0.002
subependymal giant cell astrocytoma -1.660 0.011
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.300 0.006
ovarian cancer -1.800 0.000

AA Sequence

MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDL      1 - 70
EAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSA     71 - 140
YLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPVAADLEMAAGLT    141 - 210
DIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK                        211 - 260
//

Text Mined References (6)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.