Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 1.7e-03
astrocytic glioma -1.200 3.9e-02
atypical teratoid / rhabdoid tumor -1.300 2.1e-03
ductal carcinoma in situ -1.100 9.8e-04
ependymoma -1.100 4.2e-04
glioblastoma -1.500 2.7e-03
group 4 medulloblastoma -1.300 2.2e-03
invasive ductal carcinoma -1.300 5.9e-03
medulloblastoma, large-cell -2.600 2.2e-04
osteosarcoma -1.821 3.1e-04
ovarian cancer -1.800 1.5e-06
subependymal giant cell astrocytoma -1.660 1.1e-02

Synonym

Accession Q96BQ5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDL      1 - 70
EAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSA     71 - 140
YLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPVAADLEMAAGLT    141 - 210
DIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK                        211 - 260
//

Text Mined References (7)

PMID Year Title