Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.50399572957414E-6
medulloblastoma, large-cell 6234 2.19940765635605E-4
osteosarcoma 7933 3.09449086537101E-4
ependymoma 2514 4.20993469291925E-4
ductal carcinoma in situ 1745 9.77619969073472E-4
adult high grade glioma 2148 0.00170474765574754
atypical teratoid / rhabdoid tumor 4369 0.00211858761185279
glioblastoma 5572 0.00274438080028736
medulloblastoma 1524 0.00399017142624481
invasive ductal carcinoma 2950 0.0058848196443833
subependymal giant cell astrocytoma 2287 0.0105292581427202
astrocytic glioma 2241 0.0391657768937368

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 0.039
osteosarcoma -1.821 0.000
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.300 0.002
glioblastoma -1.500 0.003
medulloblastoma -1.300 0.004
medulloblastoma, large-cell -2.600 0.000
adult high grade glioma -1.400 0.002
subependymal giant cell astrocytoma -1.660 0.011
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.300 0.006
ovarian cancer -1.800 0.000

Synonym

Accession Q96BQ5
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

AA Sequence

MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDL      1 - 70
EAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSA     71 - 140
YLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPVAADLEMAAGLT    141 - 210
DIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK                        211 - 260
//

Text Mined References (6)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.