Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $71,209.67
PubMed Score 3.86
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96BF3 Q6UW59
Symbols CD28H
IGPR1
IGPR-1

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
23784006 B7 homologue 5 (B7-H5), was identified as a specific ligand for CD28H.
22419821 Authors identified IGPR-1, also called TMIGD2, gene as a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins.

AA Sequence

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY      1 - 70
ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ     71 - 140
NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCS    141 - 210
GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG    211 - 280
EE                                                                        281 - 282
//

Text Mined References (7)

PMID Year Title
23784006 2013 B7-H5 costimulates human T cells via CD28H.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.