Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.16
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY      1 - 70
ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ     71 - 140
NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCS    141 - 210
GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG    211 - 280
EE                                                                        281 - 282
//

Text Mined References (8)

PMID Year Title