Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.86
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96BF3 Q6UW59
Symbols CD28H
IGPR1
IGPR-1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid

 CSPA Cell Line (2)

Gene RIF (2)

PMID Text
23784006 B7 homologue 5 (B7-H5), was identified as a specific ligand for CD28H.
22419821 Authors identified IGPR-1, also called TMIGD2, gene as a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins.

AA Sequence

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPY      1 - 70
ITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQ     71 - 140
NRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCS    141 - 210
GEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG    211 - 280
EE                                                                        281 - 282
//

Text Mined References (7)

PMID Year Title
23784006 2013 B7-H5 costimulates human T cells via CD28H.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.