Property Summary

NCBI Gene PubMed Count 22
Grant Count 19
R01 Count 14
Funding $1,334,701.17
PubMed Score 10.13
PubTator Score 11.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25288561 RAD51AP1 is required for the maintenance of DNA replication fork progression.
22452920 Data suggest that microRNA/mRNA pairs in hsa-miR-140-3p/RAD51AP1/, hsa-miR-145/E2F3, hsa-miR-139-5p/TOP2A, and hsa-miR-133a/GCLC were correlated with ovarian tumorigenesis.
22375013 We have finely mapped the two DNA binding domains in RAD51AP1 and using mutant variants, reveal that both domains are indispensable for RAD51AP1 function in cells.
21903585 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21307306 RAD51AP1 foci colocalize with a subset of DMC1 foci in spermatocytes.
20871616 Although PALB2 alone stimulates D-loop formation, it has a cooperative effect with RAD51AP1, an enhancer of RAD51.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18316552 Enhanced expression of RAD51 associating protein-1 is involved in the growth of intrahepatic cholangiocarcinoma
17996711 RAD51AP1 helps maintain genomic integrity via RAD51 recombinase enhancement.
17996710 RAD51AP1 has a selective affinity for branched-DNA structures that are obligatory intermediates during joint molecule formation.
More...

AA Sequence

MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKR      1 - 70
LPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSP     71 - 140
HISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDS    141 - 210
DFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVS    211 - 280
LSSDTTRKPLEIRSPSAESKKPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNAT    281 - 350
ST                                                                        351 - 352
//

Text Mined References (29)

PMID Year Title
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
25416956 2014 A proteome-scale map of the human interactome network.
25288561 2014 RAD51AP1-deficiency in vertebrate cells impairs DNA replication.
23754376 2013 FIGNL1-containing protein complex is required for efficient homologous recombination repair.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22452920 2012 Identifying microRNA/mRNA dysregulations in ovarian cancer.
22375013 2012 Mechanistic insights into RAD51-associated protein 1 (RAD51AP1) action in homologous DNA repair.
21903585 2011 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...