Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.64
PubTator Score 11.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 2.282 2.8e-04
adult high grade glioma 2.100 3.9e-05
atypical teratoid / rhabdoid tumor 2.100 1.7e-06
Breast cancer 2.200 4.5e-02
breast carcinoma 1.100 9.4e-05
colon cancer 1.400 6.5e-03
ductal carcinoma in situ 2.200 3.9e-04
Endometriosis 1.459 2.5e-02
ependymoma 1.100 1.9e-05
glioblastoma 2.600 3.1e-11
group 3 medulloblastoma 3.000 6.3e-07
intraductal papillary-mucinous carcinoma... 2.600 6.2e-04
intraductal papillary-mucinous neoplasm ... 3.400 1.4e-03
invasive ductal carcinoma 2.400 8.5e-04
lung adenocarcinoma 1.100 1.5e-07
lung cancer 3.100 1.3e-05
malignant mesothelioma 1.900 3.0e-07
medulloblastoma, large-cell 2.300 7.2e-05
nasopharyngeal carcinoma 2.200 1.5e-05
non-small cell lung cancer 2.321 4.7e-23
ovarian cancer 2.500 7.6e-05
pancreatic cancer 1.600 1.2e-04
primary Sjogren syndrome 1.300 8.0e-03
primitive neuroectodermal tumor 2.800 4.2e-06
psoriasis 1.700 1.6e-12

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (13)

AA Sequence

MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKR      1 - 70
LPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSP     71 - 140
HISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDS    141 - 210
DFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVS    211 - 280
LSSDTTRKPLEIRSPSAESKKPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNAT    281 - 350
ST                                                                        351 - 352
//

Text Mined References (31)

PMID Year Title