Property Summary

NCBI Gene PubMed Count 16
Grant Count 107
R01 Count 48
Funding $13,972,029.99
PubMed Score 155.79
PubTator Score 175.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96AZ6 O00441 O00586
Symbols CD25
HEM45

Gene

PDB

1WLJ  

Gene RIF (8)

PMID Text
26116899 HIV-1 Vpr upregulates the expression of ISG20 in human monocyte-derived dendritic cells
25170834 HIV-1 Vpr upregulates the expression of ISG20 in human monocyte-derived dendritic cells
23830076 The results suggest that hantavirus infection interferes with DAXX-mediated apoptosis, and expression of interferon-activated Sp100 and ISG-20 proteins may indicate intracellular intrinsic antiviral attempts.
22647704 HIV-1 Vpr upregulates the expression of ISG20 in human monocyte-derived dendritic cells
21036379 ISG20 inhibited infections by hepatitis C virus, bovine viral diarrhea virus and hepatitis A virus. Moreover, ISG20 demonstrated cell-type specific antiviral activity against yellow fever virus, a classical flavivirus.
18278447 ISG20 has a role in reducing the synthesis of HBV proteins
15527770 ISG20has distinctive residues, Met14 and Arg53, to accommodate hydrogen bonds with the 2'-OH group of the UMP ribose, and these residues may be responsible for the preference of ISG20 for RNA substrates
12539042 HIV-1 Vpr upregulates the expression of ISG20 in human monocyte-derived dendritic cells

AA Sequence

MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF      1 - 70
AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK     71 - 140
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSD                                 141 - 181
//

Text Mined References (19)

PMID Year Title
23830076 2013 Death-domain associated protein-6 (DAXX) mediated apoptosis in hantavirus infection is counter-balanced by activation of interferon-stimulated nuclear transcription factors.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21732829 2011 Wnt signaling and Dupuytren's disease.
21269460 2011 Initial characterization of the human central proteome.
21036379 2011 Antiviral activities of ISG20 in positive-strand RNA virus infections.
18278447 2008 Cloning, eukaryotic expression of human ISG20 and preliminary study on the effect of its anti-HBV.
17445960 ISG20, an actor of the innate immune response.
16514659 2006 The exonuclease ISG20 mainly localizes in the nucleolus and the Cajal (Coiled) bodies and is associated with nuclear SMN protein-containing complexes.
16033969 2005 Interferon-induced exonuclease ISG20 exhibits an antiviral activity against human immunodeficiency virus type 1.
15527770 2004 Crystal structure of human ISG20, an interferon-induced antiviral ribonuclease.
More...