Property Summary

NCBI Gene PubMed Count 19
PubMed Score 177.99
PubTator Score 175.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.294 1.5e-02
Astrocytoma, Pilocytic 1.500 3.0e-07
cutaneous lupus erythematosus 4.200 4.9e-05
cystic fibrosis 1.800 2.7e-03
dermatomyositis 1.600 2.8e-02
ductal carcinoma in situ 1.300 2.8e-02
Endometriosis -1.846 6.7e-03
glioblastoma 1.400 2.4e-04
interstitial cystitis 3.100 1.2e-03
intraductal papillary-mucinous adenoma (... 3.000 1.9e-04
intraductal papillary-mucinous carcinoma... 2.100 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.400 4.9e-03
invasive ductal carcinoma 1.800 4.6e-03
juvenile dermatomyositis 1.559 5.6e-09
lung cancer -1.500 2.6e-03
malignant mesothelioma 3.300 1.0e-08
Multiple myeloma 1.002 2.5e-02
Multiple Sclerosis 1.200 3.4e-02
non primary Sjogren syndrome sicca 1.100 3.0e-02
osteosarcoma -3.117 8.6e-05
ovarian cancer 1.200 1.5e-02
pancreatic cancer 1.600 4.1e-04
pediatric high grade glioma 1.400 4.5e-04
pituitary cancer -2.800 2.4e-09
psoriasis 1.300 1.7e-05
ulcerative colitis 1.200 2.5e-04

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF      1 - 70
AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK     71 - 140
SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSD                                 141 - 181
//

Text Mined References (22)

PMID Year Title