Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ      1 - 70
NVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVF     71 - 140
PANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDED    141 - 210
ENVNIYRARHREPRPA                                                          211 - 226
//

Text Mined References (12)

PMID Year Title