Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession Q96AZ1 Q9H749 Q9Y3W2
Symbols FAM119B

Gene

PDB

4QPN  

Gene RIF (2)

PMID Text
22948820 The METTL21B protein is here suggested to be a protein methyltransferase, as it is shown to belong to a family of 10 human methyltransferases, some of which are shown to have lysine specific protein methyltransferase activity.
20190274 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ      1 - 70
NVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVF     71 - 140
PANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDED    141 - 210
ENVNIYRARHREPRPA                                                          211 - 226
//

Text Mined References (11)

PMID Year Title
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
20190274 2010 The multiple sclerosis whole blood mRNA transcriptome and genetic associations indicate dysregulation of specific T cell pathways in pathogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...