Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 5
Funding $782,413
PubMed Score 43.46
PubTator Score 8.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.400 0.000
Atopic dermatitis 1.100 0.000
adult high grade glioma -1.400 0.001

Gene RIF (8)

PMID Text
25565632 Here, we report a novel interaction between CYLD and MIB2 that supports the hypothesis that the CYLD/MIB2 interaction might play a pathogenic role in human cancer.
25142606 The DLAIS motif in MAVS was found to be critical for MIB2 binding, the ligation of K63-linked ubiquitin to TANK-binding kinase 1, and phosphorylation-mediated IRF3/7 activation.
21896478 identify MIB2 as a novel component of the activated BCL10 signaling complex and a missing link in the BCL10-dependent NF-kappaB signaling pathway.
17962190 Data identify Mind bomb-2 as an E3 ubiquitin ligase that interacts with and ubiquitinates the NR2B subunit of the NMDAR in mammalian cells.
16715130 skeletrophin might be a novel suppressor factor for melanoma invasion
15920166 skeletrophin is a novel ubiquitin ligase that targets the intracellular region of Jagged-2 and is aberrantly overexpressed in multiple myeloma cells.
15869411 Skeletrophin, a novel RING molecule controlled by the chromatin remodeling complex, is down-regulated in melanoma.
15824097 Mib2 has functional similarities to Mib1, but might have distinct roles in Notch signaling as an E3 ubiquitin ligase

AA Sequence

MGWKPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAARPTMDPSAHRSRAAPPNMDPDPQAGVQVG      1 - 70
MRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQI     71 - 140
GVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRI    141 - 210
PLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLK    211 - 280
CVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQ    281 - 350
TGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALG    351 - 420
RVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEH    421 - 490
PGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTAL    491 - 560
HYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAI    561 - 630
SAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAA    631 - 700
LNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRH    701 - 770
QLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRV    771 - 840
LKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTV    841 - 910
CEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRYRQMEERITCPICIDSHIRLV    911 - 980
FQCGHGACAPCGSALSACPICRQPIRDRIQIFV                                         981 - 1013
//

Text Mined References (25)

PMID Year Title
25565632 2014 The cylindromatosis gene product, CYLD, interacts with MIB2 to regulate notch signalling.
25142606 2014 Lysine 63-linked TANK-binding kinase 1 ubiquitination by mindbomb E3 ubiquitin protein ligase 2 is mediated by the mitochondrial antiviral signaling protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21896478 2011 The E3 ubiquitin ligase mind bomb-2 (MIB2) protein controls B-cell CLL/lymphoma 10 (BCL10)-dependent NF-?B activation.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962190 2008 Mind bomb-2 is an E3 ligase that ubiquitinates the N-methyl-D-aspartate receptor NR2B subunit in a phosphorylation-dependent manner.
More...