Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $386,189.16
PubMed Score 4.62
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.600 0.000
malignant mesothelioma 2.000 0.000
psoriasis 1.100 0.001
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.300 0.003
Breast cancer 3.800 0.026
group 4 medulloblastoma -1.100 0.001
pancreatic carcinoma 1.600 0.000
invasive ductal carcinoma -1.260 0.000
ovarian cancer 1.600 0.004

Synonym

Accession Q96AQ8 Q96JS7 Q9H7F8 MCU regulator 1
Symbols FMP32
C6orf79
CCDC90A

Gene

Gene RIF (4)

PMID Text
27001609 Data suggest that MCU regulator (EMRE) might be a structural factor for opening of the mitochondrial calcium uniporter (MCU)-forming pore.
26976564 MCUR1 regulates the calcium threshold for the mitochondrial permeability transition.
25565209 CCDC90A is not directly implicated in MCU function, and that the Ca2+ uptake defect associated with loss of CCDC90A function is likely secondary to the respiratory chain deficiency.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDCGSVGGQRTQRLPGRQRLLFLPVGLSGRPGGSETSARRCLSALSDGLGALRPRAPAARGGVSRASPLL      1 - 70
LLLLVPSPRLAAAAPRRQLGDWERSRLGYAAPPAGRSSAWRCSPGVAAAAGALPQYHGPAPALVSCRREL     71 - 140
SLSAGSLQLERKRRDFTSSGSRKLYFDTHALVCLLEDNGFATQQAEIIVSALVKILEANMDIVYKDMVTK    141 - 210
MQQEITFQQVMSQIANVKKDMIILEKSEFSALRAENEKIKLELHQLKQQVMDEVIKVRTDTKLDFNLEKS    211 - 280
RVKELYSLNEKKLLELRTEIVALHAQQDRALTQTDRKIETEVAGLKTMLESHKLDNIKYLAGSIFTCLTV    281 - 350
ALGFYRLWI                                                                 351 - 359
//

Text Mined References (15)

PMID Year Title
27184846 2016 MCUR1 Is a Scaffold Factor for the MCU Complex Function and Promotes Mitochondrial Bioenergetics.
27001609 2016 Analysis of the structure and function of EMRE in a yeast expression system.
26976564 2016 Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition.
26445506 2015 MCUR1, CCDC90A, Is a Regulator of the Mitochondrial Calcium Uniporter.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25565209 2015 CCDC90A (MCUR1) is a cytochrome c oxidase assembly factor and not a regulator of the mitochondrial calcium uniporter.
23178883 2012 MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...