Property Summary

Ligand Count 1
NCBI Gene PubMed Count 91
PubMed Score 486.42
PubTator Score 555.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 9.0e-04
ductal carcinoma in situ -1.800 9.2e-04
fibroadenoma -1.500 3.2e-02
glioblastoma 1.300 2.8e-04
invasive ductal carcinoma -2.300 1.4e-03
medulloblastoma, large-cell 1.500 3.4e-06
osteosarcoma -1.223 7.5e-03
ovarian cancer -1.100 1.0e-05
psoriasis 1.300 1.8e-03
Rheumatoid arthritis -1.200 3.1e-02

Protein-protein Interaction (3)

Gene RIF (84)

AA Sequence

MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGVCLGEAGAKFI      1 - 70
EVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDELIQ     71 - 140
ANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNT    141 - 210
SIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVE    211 - 280
SAQAEDYSQLPGEDHILEHLPARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTI    281 - 350
RLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP    351 - 420
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQLAGPAPLLST    421 - 490
PAPEARPVIGALGL                                                            491 - 504
//

Text Mined References (102)

PMID Year Title