Property Summary

NCBI Gene PubMed Count 80
Grant Count 247
R01 Count 104
Funding $20,916,476.4
PubMed Score 430.85
PubTator Score 555.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.031
psoriasis 1.300 0.002
osteosarcoma -1.223 0.007
atypical teratoid / rhabdoid tumor 1.200 0.001
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.500 0.000
fibroadenoma -1.500 0.032
ductal carcinoma in situ -1.800 0.001
invasive ductal carcinoma -2.300 0.001
ovarian cancer -1.100 0.000

Synonym

Accession Q96AD5 O60643 Q5EFF5 Q6XYE5 Q96ET6 Q9NQ61 Q9NQ62
Symbols ATGL
TTS2
PEDF-R
FP17548
TTS-2.2
iPLA2zeta
1110001C14Rik

Gene

Gene RIF (74)

PMID Text
26882978 Rab32 controls intracellular lipid accumulation through inducing lipolysis via enhancing ATGL expression indirectly.
26600210 PNPLA2 mutations were associated with an extended phenotype, including brain involvement in cases of neutral lipid-storage disease with myopathy.
26569053 ANGPTL8 is a stress-response protein that down-regulates expression of ATGL.
26330055 Authors show that rat ATGL, coactivated by rat CGI-58, efficiently hydrolyzes triglycerides and retinyl ester.
26318046 Data indicate that a tumor suppressor mechanism by which G0/G1 switch gene 2 product (G0S2) directly inhibits activity of a key intracellular adipose triglyceride lipase (ATGL).
25985012 Distinct cardiac phenotype between two homozygotes born in a village with accumulation of a genetic deficiency of adipose triglyceride lipase.
25956450 Study reports the clinical and genetic findings of a neutral lipid storage disease with myopathy family of Italian origin with 3 affected siblings. to highlight the effect that different gene mutations may have on ATGL lipase activity, authors performed a functional characterization of the novel PNPLA2 missense mutations identified in their patients
25700221 Data suggest that pigment epithelium-derived factor (PEDF) and adipose triglyceride lipase (ATGL) may serve as therapeutic targets for managing vascular hyperpermeability in sepsis.
25258314 Data indicate that the peptide corresponding to residues Lys-20 to Ala-52 from G0S2 Inhibits ATGL in the nanomolar range.
25177954 Results indicate that the serum adipose triglyceride lipase (ATGL) level may be closely related to obesity.
More...

AA Sequence

MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGVCLGEAGAKFI      1 - 70
EVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDELIQ     71 - 140
ANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNT    141 - 210
SIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVE    211 - 280
SAQAEDYSQLPGEDHILEHLPARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTI    281 - 350
RLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP    351 - 420
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQLAGPAPLLST    421 - 490
PAPEARPVIGALGL                                                            491 - 504
//

Text Mined References (91)

PMID Year Title
26882978 2016 Depletion of Rab32 decreases intracellular lipid accumulation and induces lipolysis through enhancing ATGL expression in hepatocytes.
26600210 2016 Neutral lipid-storage disease with myopathy and extended phenotype with novel PNPLA2 mutation.
26569053 2016 Angiopoietin-like protein 8 (betatrophin) is a stress-response protein that down-regulates expression of adipocyte triglyceride lipase.
26330055 2015 ATGL and CGI-58 are lipid droplet proteins of the hepatic stellate cell line HSC-T6.
26318046 2015 Inhibition of adipose triglyceride lipase (ATGL) by the putative tumor suppressor G0S2 or a small molecule inhibitor attenuates the growth of cancer cells.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25985012 2015 Distinct cardiac phenotype between two homozygotes born in a village with accumulation of a genetic deficiency of adipose triglyceride lipase.
25956450 Novel missense mutations in PNPLA2 causing late onset and clinical heterogeneity of neutral lipid storage disease with myopathy in three siblings.
25700221 2015 Pigment epithelium-derived factor regulates microvascular permeability through adipose triglyceride lipase in sepsis.
25258314 2014 A peptide derived from G0/G1 switch gene 2 acts as noncompetitive inhibitor of adipose triglyceride lipase.
More...