Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.50
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.018 0.006

Gene RIF (2)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of isochorismatase domain containing 2 (ISOC2) expression by HIV-1 Vpr in Vpr transduced macrophages
17658461 ISOC2 is a novel functional protein, which is able to bind and co-localize with a tumor suppressor gene p16(INK4a).

AA Sequence

MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVP      1 - 70
ELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDACSSRS     71 - 140
QVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH         141 - 205
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17658461 2007 Identification and characterization of a novel protein ISOC2 that interacts with p16INK4a.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
14718380 2004 Closing the gaps on human chromosome 19 revealed genes with a high density of repetitive tandemly arrayed elements.
More...