Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.50
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Osteoarthritis 184 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115
Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 5.7e-03
Disease Target Count Z-score Confidence
Varicocele 26 3.958 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.018 5.7e-03

Gene RIF (2)

AA Sequence

MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVP      1 - 70
ELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDACSSRS     71 - 140
QVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH         141 - 205
//

Text Mined References (12)

PMID Year Title