Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.61
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.456 1.2e-03
adult high grade glioma -1.200 1.2e-02
Alzheimer's disease 1.200 2.0e-02
atypical teratoid / rhabdoid tumor -1.700 1.3e-04
gastric cancer 1.200 7.1e-04
glioblastoma -1.200 1.7e-03
group 3 medulloblastoma -1.700 2.1e-03
lung carcinoma 2.000 3.2e-18
medulloblastoma, large-cell -1.800 2.0e-03
mucosa-associated lymphoid tissue lympho... -1.084 1.8e-02
osteosarcoma 1.238 4.5e-02
ovarian cancer -1.400 2.2e-06
Pick disease 1.200 5.9e-03
pituitary cancer 2.700 2.4e-08
progressive supranuclear palsy 1.500 6.8e-03

Gene RIF (4)

AA Sequence

MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVSKLEREKTQEAKRIRELEQRKHTVLV      1 - 70
TELKAKLHEEKMKELQAVRENLIKQHEQEMSRTVKVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREE     71 - 140
ARKLFDTERLKLLQEIADLKTAKKQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLM    141 - 210
DEIKAKDRIIFSLEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPD    211 - 280
LRRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDELMVSLQRMEEK    281 - 350
LKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQQNIIDELTRDREKLIRRRKHR    351 - 420
RSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRTPATPDDDLDESLAAEESELRFRQLTKEYQALQR    421 - 490
AYALLQEQTGGIIDAEREAKAQEQLQAEVLRYKAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKI    491 - 560
EKQEAENHRLQQELQDARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIP    561 - 630
DLIKQLDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKIKGYLEE    631 - 700
ELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSEKQQEELRTAVEKLRRQMLRKSREYDCQIL    701 - 770
QERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKSNRKHG                                  771 - 810
//

Text Mined References (23)

PMID Year Title