Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.61
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.200 0.001
osteosarcoma 1.238 0.045
glioblastoma -1.800 0.001
group 4 medulloblastoma -2.600 0.002
atypical teratoid / rhabdoid tumor -2.600 0.001
medulloblastoma, large-cell -2.300 0.008
adrenocortical carcinoma 1.456 0.001
pediatric high grade glioma -1.400 0.002
lung carcinoma 2.000 0.000
Alzheimer's disease 1.200 0.020
Pick disease 1.200 0.006
progressive supranuclear palsy 1.500 0.007
mucosa-associated lymphoid tissue lympho... -1.084 0.018
ovarian cancer -1.400 0.000
pituitary cancer 2.700 0.000

Gene RIF (4)

PMID Text
20890944 Liver involvement shown by janus kinase 2 positivity in a myeloproliferative neoplasm.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)
17572408 NECC 1 & 2 proteins primarily expressed in (neuro)endocrine tissues in vertebrates thus supporting a role for these proteins in the regulated secretory pathway.

AA Sequence

MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVSKLEREKTQEAKRIRELEQRKHTVLV      1 - 70
TELKAKLHEEKMKELQAVRENLIKQHEQEMSRTVKVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREE     71 - 140
ARKLFDTERLKLLQEIADLKTAKKQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLM    141 - 210
DEIKAKDRIIFSLEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPD    211 - 280
LRRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDELMVSLQRMEEK    281 - 350
LKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQQNIIDELTRDREKLIRRRKHR    351 - 420
RSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRTPATPDDDLDESLAAEESELRFRQLTKEYQALQR    421 - 490
AYALLQEQTGGIIDAEREAKAQEQLQAEVLRYKAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKI    491 - 560
EKQEAENHRLQQELQDARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIP    561 - 630
DLIKQLDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKIKGYLEE    631 - 700
ELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSEKQQEELRTAVEKLRRQMLRKSREYDCQIL    701 - 770
QERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKSNRKHG                                  771 - 810
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22250954 2012 The Golgi-associated long coiled-coil protein NECC1 participates in the control of the regulated secretory pathway in PC12 cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
17971050 2008 Fine mapping study in Scandinavian families suggests association between coeliac disease and haplotypes in chromosome region 5q32.
17572408 2007 Identification and characterization of two novel (neuro)endocrine long coiled-coil proteins.
17551518 2007 A comprehensive screen for SNP associations on chromosome region 5q31-33 in Swedish/Norwegian celiac disease families.
17471488 2007 Global gene expression profiling of PAX-FKHR fusion-positive alveolar and PAX-FKHR fusion-negative embryonal rhabdomyosarcomas.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...