Property Summary

NCBI Gene PubMed Count 13
Grant Count 28
R01 Count 12
Funding $6,019,844.1
PubMed Score 44.76
PubTator Score 34.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Multiple Sclerosis 498
osteosarcoma 7,933

Gene RIF (1)

PMID Text
19401215 The results demonstrate that TIP39 and the PTH2R are expressed in the brain of primates in locations that suggest involvement in regulation of fear, anxiety, reproductive behaviors, release of pituitary hormones, and nociception.

AA Sequence

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA      1 - 70
FRERARLLAALERRHWLNSYMHKLLVLDAP                                             71 - 100
//

Text Mined References (13)

PMID Year Title
19401215 2009 Parathyroid hormone 2 receptor and its endogenous ligand tuberoinfundibular peptide of 39 residues are concentrated in endocrine, viscerosensory and auditory brain regions in macaque and human.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14988434 2004 Agonist-specific regulation of parathyroid hormone (PTH) receptor type 2 activity: structural and functional analysis of PTH- and tuberoinfundibular peptide (TIP) 39-stimulated desensitization and internalization.
12754053 2003 PTH2 receptor-mediated inhibitory effect of parathyroid hormone and TIP39 on cell proliferation.
12559132 2003 Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12098667 2002 Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11861531 2002 Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.
More...