Property Summary

NCBI Gene PubMed Count 14
PubMed Score 44.06
PubTator Score 34.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.7e-08
Multiple Sclerosis 540 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple Sclerosis 1.100 1.4e-02
osteosarcoma 1.563 5.7e-08

Gene RIF (2)

AA Sequence

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA      1 - 70
FRERARLLAALERRHWLNSYMHKLLVLDAP                                             71 - 100
//

Text Mined References (14)

PMID Year Title