Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.03
PubTator Score 5.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.94701634909632E-14
psoriasis 6685 2.98099808604398E-13
ulcerative colitis 2087 2.37486001779676E-8
atypical teratoid / rhabdoid tumor 4369 4.20608720157004E-8
interstitial cystitis 2299 1.20783801624305E-5
medulloblastoma 1524 1.82132304056227E-5
medulloblastoma, large-cell 6234 1.9920784745367E-5
primitive neuroectodermal tumor 3031 2.54155481925539E-5
ovarian cancer 8492 4.38155405872028E-5
cystic fibrosis 1670 7.14819013076501E-5
lung cancer 4473 9.35992267044612E-5
pediatric high grade glioma 2712 4.46475064239048E-4
malignant mesothelioma 3163 6.03931478456649E-4
Pick disease 1893 6.1097561766064E-4
pituitary cancer 1972 6.81312437372583E-4
primary pancreatic ductal adenocarcinoma 1271 7.85196529370566E-4
pancreatic cancer 2300 8.84073622581826E-4
Multiple myeloma 1328 0.0011111583263247
glioblastoma 5572 0.00146880169752988
Waldenstrons macroglobulinemia 765 0.0137670119628801
astrocytic glioma 2241 0.0175332947391641
esophageal adenocarcinoma 737 0.0214020317316477
subependymal giant cell astrocytoma 2287 0.0365979671119821
gastric carcinoma 832 0.0383958991009157
osteosarcoma 7933 0.0390816239837686

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.179 0.014
Multiple myeloma 1.892 0.001
malignant mesothelioma 1.100 0.001
astrocytic glioma -2.000 0.018
esophageal adenocarcinoma -1.300 0.021
glioblastoma -2.300 0.001
osteosarcoma -1.079 0.039
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.100 0.000
primary pancreatic ductal adenocarcinoma -1.468 0.001
non-small cell lung cancer 1.220 0.000
lung cancer 1.400 0.000
ulcerative colitis -1.900 0.000
interstitial cystitis -2.400 0.000
cystic fibrosis -1.300 0.000
pediatric high grade glioma -1.800 0.000
subependymal giant cell astrocytoma 1.334 0.037
psoriasis 1.100 0.000
Pick disease -1.500 0.001
gastric carcinoma -1.200 0.038
ovarian cancer 2.200 0.000
pituitary cancer 1.100 0.001
pancreatic cancer -1.500 0.001

Synonym

Accession Q96A26 Q9NRN6 Q9UJX8
Symbols E2IG5
HGTD-P
C3orf28

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20840676 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer
19520982 HGTD-P plays a proapoptotic role in the developing rat brain following hypoxia-ischemia by activating caspase 3 and inducing the translocation of apoptosis-inducing factor (AIF) to the nucleus.
19269009 human growth and transformation-dependent protein expression is a common occurrence during the progression from a normal gastric mucosa to an intestinal-type carcinoma and may be associated with tumor cell proliferation activity
16698020 Heat shock protein 90 physically interacts with HGTD-P.
15082785 Data indicate that HGTD-P is a new hypoxia-inducible factor 1 alpha-responsive proapoptotic molecule that activates mitochondrial apoptotic cascades.

AA Sequence

MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI      1 - 70
LIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK     71 - 140
ARLKEEAAMKAKTE                                                            141 - 154
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20840676 2010 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
19520982 2009 Proapoptotic role of human growth and transformation-dependent protein in the developing rat brain after hypoxia-ischemia.
19269009 2009 Expression and prognostic significance of human growth and transformation-dependent protein in gastric carcinoma and gastric adenoma.
16698020 2006 Interaction of pro-apoptotic protein HGTD-P with heat shock protein 90 is required for induction of mitochondrial apoptotic cascades.
More...