Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.39
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -1.167 6.3e-03
adult high grade glioma -1.400 1.8e-03
astrocytic glioma -2.000 1.8e-02
atypical teratoid / rhabdoid tumor -2.300 4.2e-08
cystic fibrosis -1.300 7.1e-05
esophageal adenocarcinoma -1.300 2.1e-02
gastric carcinoma -1.200 3.8e-02
glioblastoma -1.300 5.8e-03
group 3 medulloblastoma -1.500 1.8e-03
interstitial cystitis -1.200 1.5e-03
lung cancer 1.300 1.2e-03
malignant mesothelioma 1.100 6.0e-04
medulloblastoma, large-cell -2.800 2.0e-05
Multiple myeloma 1.892 1.1e-03
non-small cell lung cancer 1.075 1.7e-13
osteosarcoma -1.079 3.9e-02
ovarian cancer -1.200 4.7e-04
pancreatic cancer -1.500 8.8e-04
pancreatic ductal adenocarcinoma liver m... -1.286 1.5e-02
Pick disease -1.500 6.1e-04
pituitary cancer 1.100 6.8e-04
primitive neuroectodermal tumor -1.100 1.7e-03
psoriasis 1.100 3.0e-13
subependymal giant cell astrocytoma 1.044 2.4e-02
Waldenstrons macroglobulinemia 1.179 1.4e-02

Gene RIF (6)

AA Sequence

MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI      1 - 70
LIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK     71 - 140
ARLKEEAAMKAKTE                                                            141 - 154
//

Text Mined References (15)

PMID Year Title