Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.03
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.179 0.014
Multiple myeloma 1.892 0.001
malignant mesothelioma 1.100 0.001
astrocytic glioma -2.000 0.018
esophageal adenocarcinoma -1.300 0.021
glioblastoma -2.300 0.001
osteosarcoma -1.079 0.039
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.100 0.000
primary pancreatic ductal adenocarcinoma -1.468 0.001
non-small cell lung cancer 1.220 0.000
lung cancer 1.400 0.000
ulcerative colitis -1.900 0.000
interstitial cystitis -2.400 0.000
cystic fibrosis -1.300 0.000
pediatric high grade glioma -1.800 0.000
subependymal giant cell astrocytoma 1.334 0.037
psoriasis 1.100 0.000
Pick disease -1.500 0.001
gastric carcinoma -1.200 0.038
ovarian cancer 2.200 0.000
pituitary cancer 1.100 0.001
pancreatic cancer -1.500 0.001

Synonym

Accession Q96A26 Q9NRN6 Q9UJX8
Symbols E2IG5
HGTD-P
C3orf28

Gene

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20840676 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer
19520982 HGTD-P plays a proapoptotic role in the developing rat brain following hypoxia-ischemia by activating caspase 3 and inducing the translocation of apoptosis-inducing factor (AIF) to the nucleus.
19269009 human growth and transformation-dependent protein expression is a common occurrence during the progression from a normal gastric mucosa to an intestinal-type carcinoma and may be associated with tumor cell proliferation activity
16698020 Heat shock protein 90 physically interacts with HGTD-P.
15082785 Data indicate that HGTD-P is a new hypoxia-inducible factor 1 alpha-responsive proapoptotic molecule that activates mitochondrial apoptotic cascades.

AA Sequence

MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI      1 - 70
LIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK     71 - 140
ARLKEEAAMKAKTE                                                            141 - 154
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20840676 2010 Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
19520982 2009 Proapoptotic role of human growth and transformation-dependent protein in the developing rat brain after hypoxia-ischemia.
19269009 2009 Expression and prognostic significance of human growth and transformation-dependent protein in gastric carcinoma and gastric adenoma.
16698020 2006 Interaction of pro-apoptotic protein HGTD-P with heat shock protein 90 is required for induction of mitochondrial apoptotic cascades.
More...