Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.49
PubTator Score 12.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 23 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.1e-08
psoriasis 6694 2.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.066 2.1e-08
psoriasis -2.300 2.3e-05

Gene RIF (8)

AA Sequence

MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGSGATIFALSSGQGRCGIAVIRTSGPASGHALRILTAPRD      1 - 70
LPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEA     71 - 140
GEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQLDGELGHLCRGWAETLTKALAHVEAYIDFGE    141 - 210
DDNLEEGVLEQADIEVRALQVALGAHLRDARRGQRLRSGVHVVVTGPPNAGKSSLVNLLSRKPVSIVSPE    211 - 280
PGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFL    281 - 350
ATVVASVGAQSPSDSSQRLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLTGEGLDGLLEALRKELAAVCG    351 - 420
DPSTDPPLLTRARHQHHLQGCLDALGHYKQSKDLALAAEALRVARGHLTRLTGGGGTEEILDIIFQDFCV    421 - 490
GK                                                                        491 - 492
//

Text Mined References (23)

PMID Year Title