Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q969Y0 A8K0X4 D3DN53 Q7Z2S8
Symbols FAM55C
MST115
MSTP115

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MWTNFFKLRLFCCLLAVLMVVVLVINVTQVEYLDHETVSATFIDSSGQFVSSQVTGISRNPYCGYDQQTL      1 - 70
SSQERMEEDSLLAALHRQVPDVGPVPFVKSTDPSSSYFVILNSAAFFKVGSQLEVLVHVQDFQRKPKKYG     71 - 140
GDYLQARIHSLKLQAGAVGRVVDYQNGFYKVFFTLLWPGKVKVSVSLVHPSEGIRVLQRLQEDKPDRVYF    141 - 210
KSLFRSGRISETTECNVCLPGNLPLCNFTDLYTGEPWFCFKPKKLPCSSRITHFKGGYLKGLLTAAESAF    211 - 280
FQSGVNIKMPVNSSGPDWVTVIPRRIKETNSLELSQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITEC    281 - 350
LQRKVVHLFGDSTIRQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN    351 - 420
ELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVVIRTANAQELG    421 - 490
PEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDAWEMTLAHYLPHKLHPDEVIVKNQLDMFLSFVCPLET     491 - 559
//

Text Mined References (9)

PMID Year Title