Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.365 0.000
ovarian cancer 1.100 0.001

AA Sequence

MGGRGADAGSSGGTGPTEGYSPPAASTRAAARAKARGGGRGGRRNTTPSVPSLRGAAPRSFHPPAAMSER      1 - 70
LRPRKRRRNGNEEDNHLPPQTKRSSRNPVFQDSWDTESSGSDSGGSSSSSSSSINSPDRASGPEGSLSQT     71 - 140
MAGSSPNTPQPVPEQSALCQGLYFHINQTLREAHFHSLQHRGRPLT                            141 - 186
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.