Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.95
PubTator Score 1.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 4.99180689624454E-17
lung cancer 4473 4.12045137250859E-5
pediatric high grade glioma 2712 1.56958968836659E-4
posterior fossa group A ependymoma 1511 2.32448974421884E-4
ovarian cancer 8492 5.42501065544503E-4
psoriasis 6685 7.09830095754684E-4
osteosarcoma 7933 7.77220893521032E-4
adrenocortical carcinoma 1427 0.00288877831105087
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00320992667000579
invasive ductal carcinoma 2950 0.00399487997642117
colon cancer 1475 0.00507009345400915
lung adenocarcinoma 2714 0.00708376659001751
ductal carcinoma in situ 1745 0.00825406049162577
hereditary spastic paraplegia 313 0.0147484762209336
interstitial lung disease 292 0.0239691843194911
Breast cancer 3099 0.0411172923653295
Disease Target Count Z-score Confidence
Hereditary sensory neuropathy 6 4.32 2.2

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease -1.600 0.024
psoriasis 1.700 0.001
glioblastoma multiforme 1.100 0.000
osteosarcoma 1.702 0.001
hereditary spastic paraplegia -1.018 0.015
adrenocortical carcinoma -1.207 0.003
pancreatic ductal adenocarcinoma liver m... -1.450 0.003
colon cancer -1.600 0.005
lung cancer -2.300 0.000
Breast cancer 2.300 0.041
pediatric high grade glioma 1.200 0.000
posterior fossa group A ependymoma 1.100 0.000
invasive ductal carcinoma 1.500 0.004
lung adenocarcinoma 1.076 0.007
ductal carcinoma in situ 1.300 0.008
ovarian cancer 2.100 0.001

Synonym

Accession Q969W0 B2RD54 D3DS93 Q8WTZ7
Symbols SSSPTA
C14orf147

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23510452 ssSPTa is identified as an LPIAT1-interacting protein.
19416851 discovery of 2 proteins, ssSPTa and ssSPTb, which each interacts with both hLCB1 and hLCB2, suggesting[ssSPTa] [ssSPTb]

AA Sequence

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIV      1 - 70
Q//

Text Mined References (7)

PMID Year Title
25691431 2015 ORMDL/serine palmitoyltransferase stoichiometry determines effects of ORMDL3 expression on sphingolipid biosynthesis.
23510452 2013 Identification of small subunit of serine palmitoyltransferase a as a lysophosphatidylinositol acyltransferase 1-interacting protein.
19416851 2009 Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.