Property Summary

NCBI Gene PubMed Count 21
PubMed Score 3.50
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tuberous sclerosis 18 3.117 1.6

Expression

Gene RIF (8)

PMID Text
24444419 oxidative stress induces Tnfaip8 l1/Oxi-beta, which results in increased autophagy by its exclusive binding with FBXW5 to stabilize TSC2
24082123 DLC1 was ubiquitinated and degraded by cullin 4A-RING ubiquitin ligase (CRL4A) complex interaction with DDB1 and the FBXW5 substrate receptor.
23314863 Identify Fbxw5-driven fluctuation of Eps8 levels as an important mechanism that contributes to cell-shape changes during entry into-and exit from-mitosis.
22910413 Fbxw5 enhances sumoylation of nuclear c-Myb
21725316 FBXW5 levels are controlled by the anaphase-promoting (APC/C) complex, which targets FBXW5 for degradation during mitosis and G1, thereby helping to reset the centrosome duplication machinery.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19232515 These results suggest that FBXW5 negatively regulates TAK1 in the IL-1beta signaling pathway.
18381890 Results indicate that FBW5-DDB1-CUL4-ROC1 is an E3 ubiquitin ligase regulating TSC2 protein stability and TSC complex turnover.

AA Sequence

MDEGGTPLLPDSLVYQIFLSLGPADVLAAGLVCRQWQAVSRDEFLWREQFYRYYQVARDVPRHPAAMSWY      1 - 70
EEFQRLYDTVPCVEVQTLREHTDQVLHLSFSHSGYQFASCSKDCTVKIWSNDLTISLLHSADMRPYNWSY     71 - 140
TQFSQFNKDDSLLLASGVFLGPHNSSSGEIAVISLDSFALLSRVRNKPYDVFGCWLTETSLISGNLHRIG    141 - 210
DITSCSVLWLNNAFQDVESENVNVVKRLFKIQNLNASTVRTVMVADCSRFDSPDLLLEAGDPATSPCRIF    211 - 280
DLGSDNEEVVAGPAPAHAKEGLRHFLDRVLEGRAQPQLSERMLETKVAELLAQGHTKPPERSATGAKSKY    281 - 350
LIFTTGCLTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDIHGHIIGMGLSPDNRYLYVN    351 - 420
SRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAED    421 - 490
RHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQELLLTASDDATIKAWRSPRTMRVLQAPRPRPRTFFSW    491 - 560
LASQRR                                                                    561 - 566
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24444419 2014 Tnfaip8 l1/Oxi-? binds to FBXW5, increasing autophagy through activation of TSC2 in a Parkinson's disease model.
24082123 2013 CRL4A-FBXW5-mediated degradation of DLC1 Rho GTPase-activating protein tumor suppressor promotes non-small cell lung cancer cell growth.
23314863 2013 SCFFbxw5 mediates transient degradation of actin remodeller Eps8 to allow proper mitotic progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22910413 2012 Fbxw5 suppresses nuclear c-Myb activity via DDB1-Cul4-Rbx1 ligase-mediated sumoylation.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
21725316 2011 The SCF-FBXW5 E3-ubiquitin ligase is regulated by PLK4 and targets HsSAS-6 to control centrosome duplication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19232515 2009 An F-box protein, FBXW5, negatively regulates TAK1 MAP3K in the IL-1beta signaling pathway.
More...