Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 5
Funding $253,510.99
PubMed Score 10.15
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
sonic hedgehog group medulloblastoma 1,482

Expression

  Differential Expression (1)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.600 0.000

Synonym

Accession Q969T9 O95638 WBP-2
Symbols WBP-2
GRAMD6

Gene

 GO Component (1)

Gene RIF (4)

PMID Text
23233354 data indicate that WBP-2 enhances ER transactivation function at certain genes by facilitating the recruitment and/or the stabilization of a histone modifier enzyme that favors a relaxed chromatin structure, permissive of transcription
21981024 The WW1 and WW2 domains of YAP2 recognize various PPXY motifs within WBP2 and WBP1 in a highly promiscuous and subtle manner.
20972459 Data show that direct interaction of Wbp2 with TAZ depends on the WW domain of TAZ.
16772533 WW domain binding protein-2, an E6-associated protein interacting protein, acts together with YAP as coactivators of estrogen and progesterone receptors.

AA Sequence

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSF      1 - 70
MMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPS     71 - 140
GAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSG    141 - 210
PDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ                       211 - 261
//

Text Mined References (21)

PMID Year Title
26881968 2016 Wbp2 is required for normal glutamatergic synapses in the cochlea and is crucial for hearing.
25416956 2014 A proteome-scale map of the human interactome network.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23233354 2013 Molecular mechanism of WW-domain binding protein-2 coactivation function in estrogen receptor signaling.
21981024 2011 Biophysical analysis of binding of WW domains of the YAP2 transcriptional regulator to PPXY motifs within WBP1 and WBP2 adaptors.
21269460 2011 Initial characterization of the human central proteome.
20972459 2011 WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ.
16772533 2006 WW domain binding protein-2, an E6-associated protein interacting protein, acts as a coactivator of estrogen and progesterone receptors.
More...