Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.77
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.4e-03
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.500 1.4e-03

Gene RIF (7)

AA Sequence

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSF      1 - 70
MMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPS     71 - 140
GAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSG    141 - 210
PDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ                       211 - 261
//

Text Mined References (26)

PMID Year Title