Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.23
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
25517131 NT5C3B is involved in airway wall thickening and thereby with airway obstruction.

AA Sequence

MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIIS      1 - 70
EECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKT     71 - 140
FFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSAC    141 - 210
ENSGYFQQLEGKTNVILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDV    211 - 280
VNGLLQHILCQGVQLEMQGP                                                      281 - 300
//

Text Mined References (11)

PMID Year Title
25517131 2015 Novel genes for airway wall thickness identified with combined genome-wide association and expression analyses.
24603684 2014 Crystal structures of the novel cytosolic 5'-nucleotidase IIIB explain its preference for m7GMP.
23223233 2013 Identification of Drosophila and human 7-methyl GMP-specific nucleotidases.
21269460 2011 Initial characterization of the human central proteome.
20706999 2010 Cytoskeletal scaffolding proteins interact with Lynch-Syndrome associated mismatch repair protein MLH1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...