Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.49
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIIS      1 - 70
EECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKT     71 - 140
FFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSAC    141 - 210
ENSGYFQQLEGKTNVILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDV    211 - 280
VNGLLQHILCQGVQLEMQGP                                                      281 - 300
//

Text Mined References (11)

PMID Year Title