Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.05
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.200 0.019
astrocytic glioma -1.400 0.019
psoriasis -2.100 0.000
osteosarcoma 1.382 0.006
glioblastoma 1.200 0.007
juvenile dermatomyositis 1.226 0.000
acute quadriplegic myopathy 1.300 0.000
primary pancreatic ductal adenocarcinoma 1.430 0.002
tuberculosis and treatment for 6 months -3.100 0.000
sarcoidosis 1.100 0.012
diabetes mellitus -1.100 0.003
Breast cancer 3.000 0.028
group 3 medulloblastoma 1.500 0.027
pancreatic carcinoma 1.200 0.019
lung adenocarcinoma 1.292 0.000
acute myeloid leukemia -1.200 0.046
ovarian cancer 2.300 0.000

Synonym

Accession Q969M3 D3DQF5 Q4VSN6 Q53EX4 Q8NHE5 Q9H338 Q9H3U4
Symbols SB140
SMAP5
YIP1A
SMAP-5
FinGER5

Gene

Gene RIF (8)

PMID Text
25742138 we propose a model for intracellular Brucella replication that exploits the host unfolded protein response and endoplasmic reticulum -derived vacuole formation machineries, both of which depend on Yip1A-mediated IRE1 activation.
23342155 Findings suggest that the ability of Yip1A to bind its established binding partners may be uncoupled from its ability to control ER whorl formation.
20237155 Results reveal a conserved Yip1A-mediated mechanism for ER membrane organization that may serve to regulate cargo exit from the organelle.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19509059 These results suggested that Yip1A has a role in COPI-independent retrograde transport from the Golgi to the ER and regulates the membrane recruitment of Rab6.
18718466 YIPF5 is not restricted to Endoplasmic Reticulum exit sites but also localized in the ER-Golgi intermediate compartment (ERGIC) and some in the cis-Golgi at steady state
15990086 Human Yip1A (YIPF5) interacts with and localizes human Yif1 (YIF1A) to the Golgi apparatus.
15922870 The highest level of expression was found in coronary smooth muscle cells, in which expression of the SMAP-5 gene was induced by transforming growth factor beta1, thus indicating that this protein may play an important role in inflammation.

AA Sequence

MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPT      1 - 70
QAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGAT     71 - 140
LLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGII    141 - 210
LTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF                           211 - 257
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25742138 2015 Yip1A, a novel host factor for the activation of the IRE1 pathway of the unfolded protein response during Brucella infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23736259 2013 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites.
23342155 2013 Identification of discrete sites in Yip1A necessary for regulation of endoplasmic reticulum structure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20237155 2010 Yip1A structures the mammalian endoplasmic reticulum.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19509059 2009 Yip1A regulates the COPI-independent retrograde transport from the Golgi complex to the ER.
18718466 2008 YIPF5 and YIF1A recycle between the ER and the Golgi apparatus and are involved in the maintenance of the Golgi structure.
More...