Property Summary

NCBI Gene PubMed Count 17
PubMed Score 317.65
PubTator Score 40.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colonic Neoplasms 142 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 4.2e-07
adrenocortical carcinoma 1428 4.8e-07
ovarian cancer 8520 2.6e-05
lung cancer 4740 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Klippel-Feil syndrome 15 3.166 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.121 4.8e-07
lung cancer 1.200 1.5e-03
osteosarcoma -2.352 4.2e-07
ovarian cancer -1.300 2.6e-05

Protein-protein Interaction (6)

Gene RIF (6)

AA Sequence

MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS      1 - 70
VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK     71 - 140
EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA    141 - 210
QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF    211 - 280
VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG    281 - 350
KRMSECPICRQYVVRAVHVFKS                                                    351 - 372
//

Text Mined References (21)

PMID Year Title