Property Summary

NCBI Gene PubMed Count 17
PubMed Score 296.58
PubTator Score 40.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Colonic Neoplasms 126
Disease Target Count P-value
osteosarcoma 7933 4.1949015342992E-7
adrenocortical carcinoma 1427 4.8348226373688E-7
ovarian cancer 8492 2.64173726005628E-5
lung cancer 4473 0.00149857012339882
Disease Target Count Z-score Confidence
Klippel-Feil syndrome 14 3.195 1.6
Colorectal adenoma 15 3.03 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.352 0.000
adrenocortical carcinoma 1.121 0.000
lung cancer 1.200 0.001
ovarian cancer -1.300 0.000

Synonym

Accession Q969K3 B7Z933 Q8NG47 Q9H6W8
Symbols RFI
RIF
RIFF
hRFI
CARP1
CARP-1

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
25012219 Data indicate that E3 ligase RNF34 is associated with nucleotide-binding oligomerization domain-containing protein 1 (NOD1).
21308745 Data indicate AE induces caspase-8-mediated activation of mitochondrial death pathways by decreasing the stability of CARP mRNAs in a p53-independent manner.
20564261 The previously unknown small molecule inhibitor-dependent interaction of Cbeta1 with the cell cycle and apoptosis regulatory protein-1 was verified.
18382127 CARPs together with MDM2 enhance p53 degradation, thereby inhibiting p53-mediated cell death.
15595643 hRFI may act as an oncogenic molecule affecting the apoptotic pathway
12118383 a novel gene, hRFI, preferentially expressed in esophageal cancer (hRFI)

AA Sequence

MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS      1 - 70
VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK     71 - 140
EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA    141 - 210
QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF    211 - 280
VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG    281 - 350
KRMSECPICRQYVVRAVHVFKS                                                    351 - 372
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25012219 2014 The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22064484 2012 RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1? and modulates brown fat cell metabolism.
21308745 2011 Destabilization of CARP mRNAs by aloe-emodin contributes to caspase-8-mediated p53-independent apoptosis of human carcinoma cells.
20564261 2010 Uncoupling of bait-protein expression from the prey protein environment adds versatility for cell and tissue interaction proteomics and reveals a complex of CARP-1 and the PKA Cbeta1 subunit.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...