Property Summary

NCBI Gene PubMed Count 17
Grant Count 186
R01 Count 84
Funding $55,414,222.17
PubMed Score 296.58
PubTator Score 40.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.352 0.000
adrenocortical carcinoma 1.121 0.000
lung cancer 1.200 0.001
ovarian cancer -1.300 0.000

Synonym

Accession Q969K3 B7Z933 Q8NG47 Q9H6W8
Symbols RFI
RIF
RIFF
hRFI
CARP1
CARP-1

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25012219 Data indicate that E3 ligase RNF34 is associated with nucleotide-binding oligomerization domain-containing protein 1 (NOD1).
21308745 Data indicate AE induces caspase-8-mediated activation of mitochondrial death pathways by decreasing the stability of CARP mRNAs in a p53-independent manner.
20564261 The previously unknown small molecule inhibitor-dependent interaction of Cbeta1 with the cell cycle and apoptosis regulatory protein-1 was verified.
18382127 CARPs together with MDM2 enhance p53 degradation, thereby inhibiting p53-mediated cell death.
15595643 hRFI may act as an oncogenic molecule affecting the apoptotic pathway
12118383 a novel gene, hRFI, preferentially expressed in esophageal cancer (hRFI)

AA Sequence

MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS      1 - 70
VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK     71 - 140
EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA    141 - 210
QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF    211 - 280
VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG    281 - 350
KRMSECPICRQYVVRAVHVFKS                                                    351 - 372
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25012219 2014 The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22064484 2012 RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1? and modulates brown fat cell metabolism.
21308745 2011 Destabilization of CARP mRNAs by aloe-emodin contributes to caspase-8-mediated p53-independent apoptosis of human carcinoma cells.
20564261 2010 Uncoupling of bait-protein expression from the prey protein environment adds versatility for cell and tissue interaction proteomics and reveals a complex of CARP-1 and the PKA Cbeta1 subunit.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...